4D7B: Human transthyretin

Structure of human transthyretin in complex with Tolcapone. Determined by X-ray diffraction at 1.15 Å resolution. Released 20 Jan 2016.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,153
Mol. weight: 28.36 kDa
Ligands: TCW
Released: 20 Jan 2016

Explore 4D7B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4D7B contains 2 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	23-24	2	1
β-strand	29-35	7	2
β-strand	41-48	8	2
β-strand	54-55	2	1
β-strand	67-73	7	2
α-helix	75-81	7
β-strand	88	1	3
β-strand	91-97	7	2
β-strand	104-112	9	1
β-strand	115-123	9	1

Chain B: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	23-24	2	1
β-strand	29-35	7	3
β-strand	41-48	8	3
β-strand	54-55	2	1
β-strand	67-73	7	3
α-helix	75-81	7
β-strand	88	1	2
β-strand	91-97	7	3
β-strand	99	1	4
β-strand	101	1	4
β-strand	104-112	9	1
β-strand	115-123	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transthyretin	A, B	protein	128	HOMO SAPIENS	P02766 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4D7B_1 TRANSTHYRETIN (chains A, B)
MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTT
AVVTNPKE

Ligands and cofactors

ID	Name	Formula	Copies
TCW	Tolcapone	C14 H11 N O5	2

Primary citation

Repositioning Tolcapone as a Potent Inhibitor of Transthyretin Amyloidogenesis and its Associated Cellular Toxicity. Reverter, D., Gallego, P., Santana, R. et al. Nat Commun (2016) 7:10787. DOI 10.1038/NCOMMS10787 · PubMed

Other PDB entries of the same protein (UniProt P02766 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F86 1.1 Å, Transthyretin THR119MET protein stabilisation
8C86 1.1 Å, Crystal structure of human transthyretin in complex with 3-O-methyltolcapone analogue 2
8W45 1.1 Å, X-ray crystal structure of V30M-TTR in complex with pinostilbene
4QXV 1.12 Å, Crystal structure of human transthyretin in complex with luteolin at 1.1 a resolution
4KY2 1.13 Å, Transthyretin in complex with the fluorescent folding sensor…
7EJQ 1.15 Å, Crystal structure of human transthyretin in complex with…
8AWI 1.15 Å, Crystal structure of Human Transthyretin at 1.15 Angstrom resolution
6TXW 1.15 Å, V30G Transthyretin structure in complex with Tolcalpone
4L1T 1.16 Å, Transthyretin in complex with (E)-3-(dimethylamino)-5-(4-hydroxy-3,5-dimethylstyryl)benzo…
4HIQ 1.18 Å, The Structure of V122I Mutant Transthyretin in Complex with AG10
9H7L 1.18 Å, Human Transthyretin in Complex with 4-phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine
8C85 1.19 Å, Crystal structure of human transthyretin in complex with 3-O-methyltolcapone analogue 1

Browse structure collections

About this viewer

MolViewer shows 4D7B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.