6TXW: V30G Transthyretin structure

V30G Transthyretin structure in complex with Tolcalpone. Determined by X-ray diffraction at 1.15 Å resolution. Released 13 May 2020.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,162
Mol. weight: 25.87 kDa
Ligands: TCW
Released: 13 May 2020

Explore 6TXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TXW contains 3 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	23-24	2	1
β-strand	29-35	7	2
β-strand	41-48	8	2
β-strand	54-55	2	1
β-strand	67-73	7	2
α-helix	75-81	7
β-strand	88	1	3
β-strand	91-97	7	2
β-strand	99	1	4
β-strand	101	1	4
β-strand	104-112	9	1
β-strand	115-123	9	1

Chain B: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	23-24	2	1
β-strand	29-35	7	3
α-helix	40	1
β-strand	41-48	8	3
β-strand	54-55	2	1
β-strand	67-73	7	3
α-helix	75-81	7
β-strand	88	1	2
β-strand	91-97	7	3
β-strand	99	1	5
β-strand	101	1	5
β-strand	104-112	9	1
β-strand	115-123	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transthyretin	A, B	protein	116	Homo sapiens	P02766 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6TXW_1 Transthyretin (chains A, B)
CPLMVKVLDAVRGSPAINVAGHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIY
KVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNP

Ligands and cofactors

ID	Name	Formula	Copies
TCW	Tolcapone	C14 H11 N O5	2

Primary citation

Tolcapone, a potent aggregation inhibitor for the treatment of familial leptomeningeal amyloidosis. Pinheiro, F., Varejao, N., Esperante, S. et al. FEBS J (2021) 288:310-324. DOI 10.1111/febs.15339 · PubMed

Other PDB entries of the same protein (UniProt P02766 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F86 1.1 Å, Transthyretin THR119MET protein stabilisation
8C86 1.1 Å, Crystal structure of human transthyretin in complex with 3-O-methyltolcapone analogue 2
8W45 1.1 Å, X-ray crystal structure of V30M-TTR in complex with pinostilbene
4QXV 1.12 Å, Crystal structure of human transthyretin in complex with luteolin at 1.1 a resolution
4KY2 1.13 Å, Transthyretin in complex with the fluorescent folding sensor…
4D7B 1.15 Å, Structure of human transthyretin in complex with Tolcapone
7EJQ 1.15 Å, Crystal structure of human transthyretin in complex with…
8AWI 1.15 Å, Crystal structure of Human Transthyretin at 1.15 Angstrom resolution
4L1T 1.16 Å, Transthyretin in complex with (E)-3-(dimethylamino)-5-(4-hydroxy-3,5-dimethylstyryl)benzo…
4HIQ 1.18 Å, The Structure of V122I Mutant Transthyretin in Complex with AG10
9H7L 1.18 Å, Human Transthyretin in Complex with 4-phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine
8C85 1.19 Å, Crystal structure of human transthyretin in complex with 3-O-methyltolcapone analogue 1

Browse structure collections

About this viewer

MolViewer shows 6TXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.