Structure of 14-3-3 sigma in complex with PADI6 14-3-3 binding motif II. Determined by X-ray diffraction at 1.4 Å resolution. Released 13 Jun 2012.
Explore 4DAT in 3D Show helices and sheets RCSB PDB PDBe
4DAT contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-31 | 13 | |
| α-helix | 35-37 | 3 | |
| α-helix | 38-66 | 29 | |
| α-helix | 80-102 | 23 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-134 | 21 | |
| α-helix | 141-161 | 21 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-202 | 16 | |
| α-helix | 205-207 | 3 | |
| α-helix | 210-230 | 21 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein sigma | A | protein | 234 | Homo sapiens | P31947 (AlphaFold model) |
| Peptidylarginine Deiminase type VI | B | protein | 9 | Homo sapiens | Q6TGC4 (AlphaFold model) |
>4DAT_1 14-3-3 protein sigma (chains A) MGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRA AWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESR VFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFS VFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
>4DAT_2 Peptidylarginine Deiminase type VI (chains B) SSFYPSAEG
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
Identification and structural characterization of two 14-3-3 binding sites in the human peptidylarginine deiminase type VI. Rose, R., Rose, M., Ottmann, C. J Struct Biol (2012) 180:65-72. DOI 10.1016/j.jsb.2012.05.010 · PubMed
Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4DAT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.