The PTB domain of Mint1 is autoinhibited by a helix in the C-terminal linker region. Determined by X-ray diffraction at 1.9 Å resolution. Released 7 Mar 2012.
Explore 4DBB in 3D Show helices and sheets RCSB PDB PDBe
4DBB contains 8 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 460-475 | 16 | 1 |
| α-helix | 478-480 | 3 | |
| α-helix | 481-493 | 13 | |
| β-strand | 517-524 | 8 | 1 |
| β-strand | 527-532 | 6 | 1 |
| β-strand | 538-543 | 6 | 1 |
| α-helix | 544-546 | 3 | |
| β-strand | 547-553 | 7 | 1 |
| β-strand | 556-563 | 8 | 1 |
| α-helix | 564 | 1 | |
| β-strand | 587-595 | 9 | 1 |
| α-helix | 599-614 | 16 | |
| α-helix | 615-617 | 3 | |
| α-helix | 625-627 | 3 | |
| α-helix | 630-639 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Amyloid beta A4 precursor protein-binding family A member 1 | A | protein | 162 | Rattus norvegicus | O35430 (AlphaFold model) |
>4DBB_1 Amyloid beta A4 precursor protein-binding family A member 1 (chains A) DPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKPEGESQPMTEVDLFIS TQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLMARRRMPRSQYKMICHVFESEDAQL IAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMY
| ID | Name | Formula | Copies |
|---|---|---|---|
| IPA | Isopropyl alcohol | C3 H8 O | 2 |
Water and common crystallization additives (GOL, ACY, CL) are not listed.
Autoinhibition of Mint1 adaptor protein regulates amyloid precursor protein binding and processing. Matos, M.F., Xu, Y., Dulubova, I. et al. Proc Natl Acad Sci U S A (2012) 109:3802-3807. DOI 10.1073/pnas.1119075109 · PubMed
Other PDB entries of the same protein (UniProt O35430 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4DBB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.