6KMH: CASK/Mint1 complex

The crystal structure of CASK/Mint1 complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 5 Aug 2020.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Homo sapiens, Rattus norvegicus
Chains: 4
Atoms: 6,001
Mol. weight: 90.43 kDa
Released: 5 Aug 2020

Explore 6KMH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KMH contains 51 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	12-21	10	1
β-strand	24-31	8	1
β-strand	37-44	8	1
α-helix	45-50	6
α-helix	56-68	13
β-strand	74	1	2
β-strand	77-83	7	1
β-strand	86-92	7	1
α-helix	93	1
β-strand	98	1	2
α-helix	99-108	10
β-strand	111	1	3
α-helix	115-134	20
β-strand	137-138	2	4
α-helix	144-146	3
β-strand	147-149	3	2
α-helix	156-157	2
β-strand	158-160	3	2
α-helix	163-165	3
β-strand	167-168	2	4
β-strand	175	1	5
α-helix	183-185	3
α-helix	188-191	4
β-strand	196	1	5
α-helix	199-214	16
α-helix	223-232	10
α-helix	239-242	4
α-helix	247-256	10
α-helix	265-266	2
α-helix	267-271	5
α-helix	274-277	4
α-helix	279-282	4
α-helix	289-300	12
α-helix	305-311	7
α-helix	314-317	4

Chain B: 22 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	12-21	10	6
β-strand	24-31	8	6
β-strand	37-44	8	6
α-helix	45-49	5
α-helix	56-68	13
β-strand	74	1	7
β-strand	77-83	7	6
β-strand	86-92	7	6
α-helix	93	1
β-strand	98	1	7
α-helix	99-108	10
β-strand	111	1	8
α-helix	115-134	20
β-strand	137-138	2	9
α-helix	144-146	3
β-strand	147-149	3	7
α-helix	156-157	2
β-strand	158-160	3	7
α-helix	163-165	3
β-strand	167-168	2	9
β-strand	175	1	10
α-helix	183-185	3
α-helix	188-191	4
β-strand	196	1	10
α-helix	199-214	16
α-helix	223-232	10
α-helix	239-242	4
α-helix	247-256	10
α-helix	265-266	2
α-helix	267-271	5
α-helix	274-277	4
α-helix	279-282	4
α-helix	289-300	12
α-helix	305-311	7
α-helix	314-318	5

Chain C: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	342-364	23
α-helix	366-369	4
α-helix	374-376	3
β-strand	383	1	3

Chain D: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	-1-339	4
α-helix	342-364	23
α-helix	366-369	4
α-helix	373-376	4
β-strand	383	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peripheral plasma membrane protein CASK	A, B	protein	325	Homo sapiens	O14936 (AlphaFold model)
Amyloid-beta A4 precursor protein-binding family A member 1	C, D	protein	66	Rattus norvegicus	O35430 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6KMH_1 Peripheral plasma membrane protein CASK (chains A, B)
GPGSEFMADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGL
STEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYS
EAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGL
VAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGK
YKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQ
LRKFNARRKLKGAVLAAVSSHKFNS

Sequence of entity 2 (C, D), FASTA

>6KMH_2 Amyloid-beta A4 precursor protein-binding family A member 1 (chains C, D)
GPGSEFQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTR
DCDDQR

Primary citation

CASK modulates the assembly and function of the Mint1/Munc18-1 complex to regulate insulin secretion. Zhang, Z., Li, W., Yang, G. et al. Cell Discov (2020) 6:92-92. DOI 10.1038/s41421-020-00216-3 · PubMed

Other PDB entries of the same protein (UniProt O14936 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KGD 1.31 Å, Crystal Structure of the Guanylate Kinase-like Domain of Human CASK
9M6G 1.7 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK-Mint1-CID complex
9KYS 1.76 Å, the Ca2+/CaM-CASK-ARD complex
9M5Y 1.8 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK complex
3C0I 1.85 Å, CASK CaM-Kinase Domain- 3'-AMP complex, P212121 form
6NH9 1.85 Å, Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK)…
6NID 1.86 Å, Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK)…
1KWA 1.93 Å, Human cask/lin-2 PDZ domain
7OAJ 1.93 Å, Crystal structure of pseudokinase CASK in complex with compound 7
3MFR 2.0 Å, CASK-4M CaM Kinase Domain, native
3MFS 2.1 Å, CASK-4M CaM Kinase Domain, AMPPNP
7OAL 2.17 Å, Crystal structure of pseudokinase CASK in complex with compound 25

Browse structure collections

About this viewer

MolViewer shows 6KMH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.