4DEY: Voltage Dependent Calcium Channel beta-2 Subunit

Crystal structure of the Voltage Dependent Calcium Channel beta-2 Subunit in Complex With The CaV1.2 I-II Linker. Determined by X-ray diffraction at 1.95 Å resolution. Released 13 Jun 2012.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Oryctolagus cuniculus
Chains: 2
Atoms: 2,606
Mol. weight: 51.94 kDa
Released: 13 Jun 2012

Explore 4DEY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DEY contains 16 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	38-40	3
α-helix	41-55	15
α-helix	60-61	2
β-strand	63-67	5	1
β-strand	71	1	2
α-helix	75-77	3
β-strand	85	1	1
β-strand	88	1	2
β-strand	93-99	7	1
β-strand	104-109	6	1
β-strand	117-120	4	1
α-helix	122-135	14
β-strand	221-224	4	1
α-helix	228-229	2
β-strand	230-233	4	3
α-helix	241-257	17
β-strand	262-267	6	3
α-helix	271-273	3
α-helix	297-310	14
β-strand	316-321	6	3
α-helix	327-329	3
β-strand	338-342	5	3
α-helix	347-355	9
α-helix	359-362	4
α-helix	365-377	13
α-helix	380-382	3
β-strand	385-387	3	3
α-helix	392-410	19

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	451-475	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-dependent L-type calcium channel subunit alpha-1C	B	protein	106	Oryctolagus cuniculus	P15381 (AlphaFold model)
Voltage-dependent L-type calcium channel subunit beta-2	A	protein	337	Oryctolagus cuniculus	P54288 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>4DEY_1 Voltage-dependent L-type calcium channel subunit alpha-1C (chains B)
GSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRN
MSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRW

Sequence of entity 2 (A), FASTA

>4DEY_2 Voltage-dependent L-type calcium channel subunit beta-2 (chains A)
SRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGM
AISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLHSK
EKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISIT
RVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTIN
HPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDV
ILDENQLEDACEHLADYLEAYWKATHPPSSNLPNPLL

Primary citation

The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis. Almagor, L., Chomsky-Hecht, O., Ben-Mocha, A. et al. J Neurosci (2012) 32:7602-7613. DOI 10.1523/JNEUROSCI.5727-11.2012 · PubMed

Other PDB entries of the same protein (UniProt P15381 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6CTB Apo-Calmodulin Bound to Calcium Voltage Gated Channel 1.2 IQ-Motif

Browse structure collections

About this viewer

MolViewer shows 4DEY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.