Bovine beta-lactoglobulin complex with linoleic acid. Determined by X-ray diffraction at 2.1 Å resolution. Released 29 Feb 2012.
Explore 4DQ4 in 3D Show helices and sheets RCSB PDB PDBe
4DQ4 contains 5 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-15 | 4 | |
| β-strand | 17-18 | 2 | 1 |
| β-strand | 20-26 | 7 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 42-48 | 7 | 1 |
| β-strand | 54-62 | 9 | 1 |
| β-strand | 65-75 | 11 | 1 |
| β-strand | 81-84 | 4 | 1 |
| β-strand | 90-97 | 8 | 1 |
| β-strand | 102-109 | 8 | 1 |
| β-strand | 117-123 | 7 | 1 |
| α-helix | 130-140 | 11 | |
| β-strand | 147-150 | 4 | 1 |
| α-helix | 153-156 | 4 | |
| α-helix | 159-161 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-lactoglobulin | A | protein | 162 | Bos taurus | P02754 (AlphaFold model) |
>4DQ4_1 Beta-lactoglobulin (chains A) LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQK WENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQ CLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Water and common crystallization additives (GOL) are not listed.
Binding of 18-carbon unsaturated fatty acids to bovine beta-lactoglobulin--structural and thermodynamic studies. Loch, J.I., Bonarek, P., Polit, A. et al. Int J Biol Macromol (2013) 57:226-231. DOI 10.1016/j.ijbiomac.2013.03.021 · PubMed
Other PDB entries of the same protein (UniProt P02754 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4DQ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.