4DX8: ICAP1

ICAP1 in complex with KRIT1 N-terminus. Determined by X-ray diffraction at 2.54 Å resolution. Released 9 Jan 2013.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: Homo sapiens
Chains: 8
Atoms: 8,128
Mol. weight: 160.56 kDa
Released: 9 Jan 2013

Explore 4DX8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DX8 contains 40 α-helices and 62 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	61-65	5	1
β-strand	66-74	9	2
α-helix	84-97	14
β-strand	110-115	6	1
β-strand	118-123	6	1
β-strand	129-134	6	1
α-helix	135-137	3
β-strand	138-145	8	2
β-strand	153-160	8	2
β-strand	167-174	8	2
α-helix	177-195	19

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	61-65	5	3
β-strand	66-75	10	2
α-helix	84-97	14
β-strand	110-115	6	3
β-strand	118-123	6	3
β-strand	129-134	6	3
α-helix	135-137	3
β-strand	138-145	8	2
β-strand	153-160	8	2
β-strand	166-173	8	2
α-helix	177-194	18

Chain D: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	61-65	5	4
β-strand	66-71	6	5
α-helix	84-98	15
β-strand	110-115	6	4
β-strand	118-123	6	4
β-strand	129-134	6	4
α-helix	135-137	3
β-strand	138-145	8	5
α-helix	152	1
β-strand	153-160	8	5
β-strand	167-174	8	5
α-helix	177-195	19

Chain E: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	61-65	5	6
β-strand	66-71	6	5
α-helix	84-97	14
β-strand	110-115	6	6
β-strand	118-123	6	6
β-strand	129-134	6	6
α-helix	135-137	3
β-strand	138-145	8	5
β-strand	153-160	8	5
β-strand	167-174	8	5
α-helix	177-195	19

Chain H: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	9-17	9	7
α-helix	30-32	3
β-strand	33-37	5	7
β-strand	38-39	2	8
β-strand	51-52	2	8
β-strand	54-57	4	7
α-helix	64-75	12
β-strand	92-98	7	7
β-strand	107-114	8	7
β-strand	131-134	4	7
α-helix	135-141	7
β-strand	149	1	8
α-helix	151-170	20
α-helix	173-178	6
α-helix	180-181	2
α-helix	182-185	4
β-strand	186-191	6	2
α-helix	193-195	3

Chain I: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	13-17	5	9
α-helix	30-32	3
β-strand	33-35	3	9
α-helix	65-75	11
β-strand	92-93	2	9
β-strand	111-114	4	9
β-strand	133-134	2	9
α-helix	135-138	4
α-helix	156-168	13
α-helix	173-177	5
α-helix	179-181	3
α-helix	182-185	4
β-strand	186-191	6	5
α-helix	193-195	3

Chain J: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	10
α-helix	30-32	3
β-strand	33-35	3	10
β-strand	54-56	3	10
α-helix	64-74	11
β-strand	92-98	7	10
β-strand	107-114	8	10
β-strand	134	1	10
α-helix	154-167	14
α-helix	173-177	5
α-helix	179-181	3
α-helix	182-185	4
β-strand	186-191	6	2

Chain K: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	14-15	2	11
β-strand	17	1	12
β-strand	33	1	12
α-helix	64-75	12
β-strand	92-93	2	13
β-strand	111-112	2	13
β-strand	113-114	2	11
α-helix	155-168	14
α-helix	173-177	5
α-helix	179-181	3
α-helix	182-185	4
β-strand	186-191	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin beta-1-binding protein 1	A, B, D, E	protein	154	Homo sapiens	O14713 (AlphaFold model)
Krev interaction trapped protein 1	H, I, J, K	protein	203	Homo sapiens	O00522 (AlphaFold model)

Sequence of entity 1 (A, B, D, E), FASTA

>4DX8_1 Integrin beta-1-binding protein 1 (chains A, B, D, E)
GSSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPP
EEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEE
YSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP

Sequence of entity 2 (H, I, J, K), FASTA

>4DX8_2 Krev interaction trapped protein 1 (chains H, I, J, K)
GPLGSMGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLE
TKLQGNSEITQGILDYVVETTKPISPANQGIRGKRVVLMKKFPLDGEKMGREASLFIVPS
VVKDNTKYTYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIP
ALFRPSPLERIKTNVINPAYATE

Primary citation

Mechanism for KRIT1 Release of ICAP1-Mediated Suppression of Integrin Activation. Liu, W., Draheim, K.M., Zhang, R. et al. Mol Cell (2013) 49:719-729. DOI 10.1016/j.molcel.2012.12.005 · PubMed

Other PDB entries of the same protein (UniProt O14713 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JIF 1.7 Å, Co-crystal structure of ICAP1 PTB domain in complex with a KRIT1 peptide
4DX9 2.99 Å, ICAP1 in complex with integrin beta 1 cytoplasmic tail

Browse structure collections

About this viewer

MolViewer shows 4DX8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.