4DZO: Mitotic spindle assembly checkpoint protein MAD1

Structure of Human Mad1 C-terminal Domain Reveals Its Involvement in Kinetochore Targeting. Determined by X-ray diffraction at 1.76 Å resolution. Released 11 Apr 2012.

Method: X-ray diffraction
Resolution: 1.76 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,201
Mol. weight: 28.13 kDa
Released: 11 Apr 2012

Explore 4DZO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DZO contains 12 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	599-637	39
β-strand	639-644	6	1
β-strand	648-653	6	1
β-strand	663-667	5	1
β-strand	675-678	4	1
α-helix	679	1
α-helix	683-685	3
α-helix	687-689	3
α-helix	690-695	6
α-helix	700-715	16

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	599-637	39
β-strand	639-643	5	2
β-strand	649-653	5	2
β-strand	663-667	5	2
β-strand	675-678	4	2
α-helix	679	1
α-helix	681-684	4
α-helix	687-689	3
α-helix	690-696	7
α-helix	700-715	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD1	A, B	protein	123	Homo sapiens	Q9Y6D9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4DZO_1 Mitotic spindle assembly checkpoint protein MAD1 (chains A, B)
GSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLY
AEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQ
TVA

Primary citation

Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting. Kim, S., Sun, H., Tomchick, D.R. et al. Proc Natl Acad Sci U S A (2012) 109:6549-6554. DOI 10.1073/pnas.1118210109 · PubMed

Other PDB entries of the same protein (UniProt Q9Y6D9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7B1F 1.75 Å, Orthorhombic P212121 Structure of Human Mad1 C-terminal Domain in Complex with…
1GO4 2.05 Å, Crystal structure of Mad1-Mad2 reveals a conserved Mad2 binding motif in Mad1 and Cdc20.
7B1H 2.4 Å, Monoclinic P21 Structure of Human Mad1 C-terminal Domain in Complex with Phosphorylated…
7B1J 2.9 Å, Orthorhombic P21212 Structure of Human Mad1 C-terminal Domain in Complex with…

Browse structure collections

About this viewer

MolViewer shows 4DZO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.