7B1J: Mitotic spindle assembly checkpoint protein MAD1

Orthorhombic P21212 Structure of Human Mad1 C-terminal Domain in Complex with Phosphorylated Bub1 CD1 Domain. Determined by X-ray diffraction at 2.9 Å resolution. Released 17 Mar 2021.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,261
Mol. weight: 33.81 kDa
Released: 17 Mar 2021

Explore 7B1J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7B1J contains 14 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	599-637	39
β-strand	639-643	5	2
β-strand	649-653	5	2
β-strand	663-667	5	2
β-strand	675-678	4	2
α-helix	679	1
α-helix	681-684	4
α-helix	687-690	4
α-helix	691-695	5
α-helix	700-713	14

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	598-637	40
β-strand	639-643	5	1
β-strand	649-653	5	1
β-strand	663-666	4	1
β-strand	676-678	3	1
α-helix	679	1
α-helix	681-685	5
α-helix	690	1
α-helix	691-696	6
α-helix	700-714	15

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	462-474	13

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	462-473	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD1	A, B	protein	122	Homo sapiens	Q9Y6D9 (AlphaFold model)
Mitotic checkpoint serine/threonine-protein kinase BUB1	C, D	protein	26	Homo sapiens	O43683 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7B1J_1 Mitotic spindle assembly checkpoint protein MAD1 (chains A, B)
SSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYA
EHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQT
VA

Sequence of entity 2 (C, D), FASTA

>7B1J_2 Mitotic checkpoint serine/threonine-protein kinase BUB1 (chains C, D)
KVQPSPTVHTKEALGFIMNMFQAPTS

Primary citation

Molecular mechanism of Mad1 kinetochore targeting by phosphorylated Bub1. Fischer, E.S., Yu, C.W.H., Bellini, D. et al. EMBO Rep (2021) 22:e52242-e52242. DOI 10.15252/embr.202052242 · PubMed

Other PDB entries of the same protein (UniProt Q9Y6D9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7B1F 1.75 Å, Orthorhombic P212121 Structure of Human Mad1 C-terminal Domain in Complex with…
4DZO 1.76 Å, Structure of Human Mad1 C-terminal Domain Reveals Its Involvement in Kinetochore Targeting
1GO4 2.05 Å, Crystal structure of Mad1-Mad2 reveals a conserved Mad2 binding motif in Mad1 and Cdc20.
7B1H 2.4 Å, Monoclinic P21 Structure of Human Mad1 C-terminal Domain in Complex with Phosphorylated…

Browse structure collections

About this viewer

MolViewer shows 7B1J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.