7B1H: Mitotic spindle assembly checkpoint protein MAD1
Monoclinic P21 Structure of Human Mad1 C-terminal Domain in Complex with Phosphorylated Bub1 CD1 Domain. Determined by X-ray diffraction at 2.4 Å resolution. Released 17 Mar 2021.
- Method
- X-ray diffraction
- Resolution
- 2.4 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 4,542
- Mol. weight
- 67.94 kDa
- Released
- 17 Mar 2021
Explore 7B1H in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7B1H contains 31 α-helices and 16 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 599-637 | 39 | |
| β-strand | 639-643 | 5 | 2 |
| α-helix | 644 | 1 | |
| β-strand | 649-653 | 5 | 2 |
| β-strand | 663-667 | 5 | 2 |
| β-strand | 675-677 | 3 | 2 |
| α-helix | 678-679 | 2 | |
| α-helix | 683-686 | 4 | |
| α-helix | 687-689 | 3 | |
| α-helix | 690-696 | 7 | |
| α-helix | 700-712 | 13 | |
Chain B: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 598-637 | 40 | |
| β-strand | 639-644 | 6 | 1 |
| β-strand | 648-653 | 6 | 1 |
| β-strand | 663-667 | 5 | 1 |
| β-strand | 675-677 | 3 | 1 |
| α-helix | 678-679 | 2 | |
| α-helix | 682-686 | 5 | |
| α-helix | 687-689 | 3 | |
| α-helix | 690-696 | 7 | |
| α-helix | 700-714 | 15 | |
Chain C: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 462-472 | 11 | |
| α-helix | 473-475 | 3 | |
Chains D and H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 462-474 | 13 | |
Chain E: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 598-637 | 40 | |
| β-strand | 639-642 | 4 | 3 |
| β-strand | 648-653 | 6 | 3 |
| β-strand | 663-667 | 5 | 3 |
| β-strand | 675-677 | 3 | 3 |
| α-helix | 678-679 | 2 | |
| α-helix | 681-686 | 6 | |
| α-helix | 687-689 | 3 | |
| α-helix | 690-696 | 7 | |
| α-helix | 700-714 | 15 | |
Chain F: 7 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 599-637 | 39 | |
| β-strand | 639-643 | 5 | 4 |
| α-helix | 644 | 1 | |
| β-strand | 649-653 | 5 | 4 |
| β-strand | 663-667 | 5 | 4 |
| β-strand | 675-677 | 3 | 4 |
| α-helix | 678-679 | 2 | |
| α-helix | 683-686 | 4 | |
| α-helix | 687-690 | 4 | |
| α-helix | 691-695 | 5 | |
| α-helix | 700-713 | 14 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 462-471 | 10 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Mitotic spindle assembly checkpoint protein MAD1 | A, B, E, F | protein | 122 | Homo sapiens | Q9Y6D9 (AlphaFold model) |
| Mitotic checkpoint serine/threonine-protein kinase BUB1 | C, D, G, H | protein | 26 | Homo sapiens | O43683 (AlphaFold model) |
Sequence of entity 1 (A, B, E, F), FASTA
>7B1H_1 Mitotic spindle assembly checkpoint protein MAD1 (chains A, B, E, F)
SSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYA
EHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQT
VA
Sequence of entity 2 (C, D, G, H), FASTA
>7B1H_2 Mitotic checkpoint serine/threonine-protein kinase BUB1 (chains C, D, G, H)
KVQPSPTVHTKEALGFIMNMFQAPTS
Primary citation
Molecular mechanism of Mad1 kinetochore targeting by phosphorylated Bub1. Fischer, E.S., Yu, C.W.H., Bellini, D. et al. EMBO Rep (2021) 22:e52242-e52242. DOI 10.15252/embr.202052242 · PubMed
Other PDB entries of the same protein (UniProt Q9Y6D9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7B1F 1.75 Å, Orthorhombic P212121 Structure of Human Mad1 C-terminal Domain in Complex with…
- 4DZO 1.76 Å, Structure of Human Mad1 C-terminal Domain Reveals Its Involvement in Kinetochore Targeting
- 1GO4 2.05 Å, Crystal structure of Mad1-Mad2 reveals a conserved Mad2 binding motif in Mad1 and Cdc20.
- 7B1J 2.9 Å, Orthorhombic P21212 Structure of Human Mad1 C-terminal Domain in Complex with…
Browse structure collections
About this viewer
MolViewer shows 7B1H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.