7B1H: Mitotic spindle assembly checkpoint protein MAD1

Monoclinic P21 Structure of Human Mad1 C-terminal Domain in Complex with Phosphorylated Bub1 CD1 Domain. Determined by X-ray diffraction at 2.4 Å resolution. Released 17 Mar 2021.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 8
Atoms: 4,542
Mol. weight: 67.94 kDa
Released: 17 Mar 2021

Explore 7B1H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7B1H contains 31 α-helices and 16 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	599-637	39
β-strand	639-643	5	2
α-helix	644	1
β-strand	649-653	5	2
β-strand	663-667	5	2
β-strand	675-677	3	2
α-helix	678-679	2
α-helix	683-686	4
α-helix	687-689	3
α-helix	690-696	7
α-helix	700-712	13

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	598-637	40
β-strand	639-644	6	1
β-strand	648-653	6	1
β-strand	663-667	5	1
β-strand	675-677	3	1
α-helix	678-679	2
α-helix	682-686	5
α-helix	687-689	3
α-helix	690-696	7
α-helix	700-714	15

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	462-472	11
α-helix	473-475	3

Chains D and H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	462-474	13

Chain E: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	598-637	40
β-strand	639-642	4	3
β-strand	648-653	6	3
β-strand	663-667	5	3
β-strand	675-677	3	3
α-helix	678-679	2
α-helix	681-686	6
α-helix	687-689	3
α-helix	690-696	7
α-helix	700-714	15

Chain F: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	599-637	39
β-strand	639-643	5	4
α-helix	644	1
β-strand	649-653	5	4
β-strand	663-667	5	4
β-strand	675-677	3	4
α-helix	678-679	2
α-helix	683-686	4
α-helix	687-690	4
α-helix	691-695	5
α-helix	700-713	14

Chain G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	462-471	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD1	A, B, E, F	protein	122	Homo sapiens	Q9Y6D9 (AlphaFold model)
Mitotic checkpoint serine/threonine-protein kinase BUB1	C, D, G, H	protein	26	Homo sapiens	O43683 (AlphaFold model)

Sequence of entity 1 (A, B, E, F), FASTA

>7B1H_1 Mitotic spindle assembly checkpoint protein MAD1 (chains A, B, E, F)
SSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYA
EHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQT
VA

Sequence of entity 2 (C, D, G, H), FASTA

>7B1H_2 Mitotic checkpoint serine/threonine-protein kinase BUB1 (chains C, D, G, H)
KVQPSPTVHTKEALGFIMNMFQAPTS

Primary citation

Molecular mechanism of Mad1 kinetochore targeting by phosphorylated Bub1. Fischer, E.S., Yu, C.W.H., Bellini, D. et al. EMBO Rep (2021) 22:e52242-e52242. DOI 10.15252/embr.202052242 · PubMed

Other PDB entries of the same protein (UniProt Q9Y6D9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7B1F 1.75 Å, Orthorhombic P212121 Structure of Human Mad1 C-terminal Domain in Complex with…
4DZO 1.76 Å, Structure of Human Mad1 C-terminal Domain Reveals Its Involvement in Kinetochore Targeting
1GO4 2.05 Å, Crystal structure of Mad1-Mad2 reveals a conserved Mad2 binding motif in Mad1 and Cdc20.
7B1J 2.9 Å, Orthorhombic P21212 Structure of Human Mad1 C-terminal Domain in Complex with…

Browse structure collections

About this viewer

MolViewer shows 7B1H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.