4EJQ: KIF1A C-CC1-FHA

Crystal structure of KIF1A C-CC1-FHA. Determined by X-ray diffraction at 1.89 Å resolution. Released 3 Oct 2012.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Homo sapiens
Chains: 8
Atoms: 10,054
Mol. weight: 139.03 kDa
Released: 3 Oct 2012

Explore 4EJQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EJQ contains 41 α-helices and 104 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	455-471	17
β-strand	474-476	3	1
β-strand	482-485	4	1
α-helix	486-488	3
β-strand	493-496	4	2
β-strand	506-510	5	2
β-strand	514-519	6	3
α-helix	526-527	2
β-strand	529-530	2	3
β-strand	539-546	8	3
α-helix	553	1
β-strand	554-559	6	3
β-strand	565-567	3	2
β-strand	570-571	2	2
α-helix	572	1
β-strand	576-577	2	3
β-strand	583-586	4	2
β-strand	590-595	6	2
α-helix	597-604	8

Chain B: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	457-468	12
β-strand	474-476	3	2
α-helix	477	1
β-strand	482-486	5	2
α-helix	487-488	2
β-strand	493-496	4	1
β-strand	508-510	3	1
β-strand	514-519	6	4
β-strand	529-530	2	4
β-strand	541-546	6	4
β-strand	554-559	6	4
β-strand	565-567	3	1
β-strand	570-571	2	1
β-strand	576-577	2	4
β-strand	583-586	4	1
β-strand	590-595	6	1
α-helix	597-602	6

Chain C: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	455-471	17
β-strand	474-476	3	5
β-strand	482-485	4	5
α-helix	486-488	3
β-strand	493-496	4	6
β-strand	508-510	3	6
β-strand	514-519	6	7
α-helix	526-527	2
β-strand	529-530	2	7
β-strand	539-546	8	7
α-helix	551-553	3
β-strand	554-559	6	7
β-strand	565-567	3	6
β-strand	570-571	2	6
β-strand	576-577	2	7
β-strand	583-586	4	6
β-strand	590-595	6	6
α-helix	597-602	6

Chain D: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	457-471	15
β-strand	474-476	3	6
β-strand	482-485	4	6
α-helix	486-488	3
β-strand	493-496	4	5
β-strand	508-510	3	5
β-strand	514-519	6	8
α-helix	526-527	2
β-strand	529-530	2	8
β-strand	541-546	6	8
α-helix	552-553	2
β-strand	554-559	6	8
β-strand	565-567	3	5
β-strand	570-571	2	5
α-helix	572	1
β-strand	576-577	2	8
β-strand	583-586	4	5
β-strand	590-595	6	5
α-helix	597-602	6

Chain E: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	457-471	15
β-strand	474-476	3	9
β-strand	482-485	4	9
α-helix	486-488	3
β-strand	493-496	4	10
β-strand	508-510	3	10
β-strand	514-519	6	11
β-strand	529-530	2	11
β-strand	541-546	6	11
α-helix	552-553	2
β-strand	554-559	6	11
β-strand	565-567	3	10
β-strand	570-571	2	10
α-helix	572	1
β-strand	576-577	2	11
β-strand	583-586	4	10
β-strand	590-595	6	10
α-helix	597-602	6

Chain F: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	455-471	17
β-strand	474-476	3	10
β-strand	482-485	4	10
α-helix	486-488	3
β-strand	493-496	4	9
β-strand	508-510	3	9
β-strand	514-519	6	12
α-helix	526-527	2
β-strand	529-530	2	12
β-strand	539-546	8	12
α-helix	551-553	3
β-strand	554-559	6	12
β-strand	565-567	3	9
β-strand	570-571	2	9
α-helix	572	1
β-strand	576-577	2	12
β-strand	583-586	4	9
β-strand	590-595	6	9
α-helix	597-602	6

Chain G: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	458-471	14
β-strand	474-476	3	13
β-strand	482-486	5	13
α-helix	487-488	2
β-strand	493-496	4	14
β-strand	508-510	3	14
β-strand	514-519	6	15
β-strand	529-530	2	15
β-strand	539-546	8	15
β-strand	554-559	6	15
α-helix	560	1
β-strand	565-567	3	14
β-strand	570-571	2	14
β-strand	576-577	2	15
β-strand	583-586	4	14
β-strand	590-595	6	14
α-helix	597-600	4

Chain H: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	455-471	17
β-strand	474-476	3	14
β-strand	482-485	4	14
α-helix	486-488	3
β-strand	493-496	4	13
β-strand	506-510	5	13
β-strand	514-519	6	16
α-helix	520	1
β-strand	529-530	2	16
β-strand	539-546	8	16
β-strand	554-559	6	16
β-strand	565-567	3	13
β-strand	570-571	2	13
α-helix	572	1
β-strand	576-577	2	16
β-strand	583-586	4	13
β-strand	590-595	6	13
α-helix	597-604	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein KIF1A	A, B, C, D, E, F, G, H	protein	154	Homo sapiens	Q12756 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>4EJQ_1 Kinesin-like protein KIF1A (chains A, B, C, D, E, F, G, H)
GSEFTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKD
GITRVGREDGERRQDIVLSGHFIKEEHCVFRSDSRGGSEAVVTLEPCEGADTYVNGKKVT
EPSILRSGNRIIMGKSHVFRFNHPEQARQERERT

Primary citation

The CC1-FHA Tandem as a Central Hub for Controlling the Dimerization and Activation of Kinesin-3 KIF1A. Huo, L., Yue, Y., Ren, J. et al. Structure (2012) 20:1550-1561. DOI 10.1016/j.str.2012.07.002 · PubMed

Other PDB entries of the same protein (UniProt Q12756 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EGX 2.51 Å, Crystal structure of KIF1A CC1-FHA tandem
8UTS 2.7 Å, KIF1A[1-393] APO in complex with a microtubule
9YA5 2.95 Å, KIF1A R350G bound to microtubules in two-heads-bound state with AMP-PNP
8UTU 3.0 Å, KIF1A[1-393] P305L mutant AMP-PNP bound one and two heads bound states merged, in…
8UTV 3.0 Å, KIF1A[1-393] P305L mutant ADP bound in complex with a microtubule
8UTN 3.1 Å, KIF1A[1-393] AMP-PNP bound two-heads-bound state in complex with a microtubule (class…
8UTQ 3.1 Å, KIF1A[1-393] AMP-PNP bound one-head-bound state in complex with a microtubule - class…
8UTT 3.1 Å, KIF1A[1-393] P305L mutant AMP-PNP bound two-heads-bound state in complex with a…
9YAI 3.12 Å, KIF1A R350W bound to microtubules in two-heads-bound state with AMP-PNP
8UTO 3.2 Å, KIF1A[1-393] AMP-PNP bound two-heads-bound state in complex with a microtubule - class…
8UTP 3.2 Å, KIF1A[1-393] - AMP-PNP two-heads-bound state in complex with a microtubule - class T3L1
9YAB 3.21 Å, KIF1A R350W bound to microtubules in the apo state

Browse structure collections

About this viewer

MolViewer shows 4EJQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.