4EOZ: SPOP BTB domain

Crystal structure of the SPOP BTB domain complexed with the Cul3 N-terminal domain. Determined by X-ray diffraction at 2.4 Å resolution. Released 30 May 2012.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,785
Mol. weight: 119.26 kDa
Released: 30 May 2012

Explore 4EOZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EOZ contains 65 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	180-184	5
α-helix	186-196	11
β-strand	202-206	5	1
β-strand	209-213	5	1
α-helix	215-221	7
α-helix	223-230	8
α-helix	234-238	5
β-strand	240-243	4	1
α-helix	248-260	13
α-helix	266-268	3
α-helix	270-279	10
α-helix	283-290	8

Chain B: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	26-45	20
α-helix	49-51	3
α-helix	54-66	13
α-helix	70-84	15
α-helix	85-89	5
α-helix	90-94	5
α-helix	101-122	22
α-helix	124-129	6
α-helix	132-134	3
α-helix	139-147	9
α-helix	148-152	5
α-helix	155-173	19
α-helix	180-192	13
α-helix	199-201	3
α-helix	202-206	5
α-helix	207-227	21
α-helix	230-251	22
α-helix	254-256	3
α-helix	257-265	9
α-helix	266-270	5
α-helix	273-277	5
α-helix	284-287	4
α-helix	293-303	11
α-helix	309-323	15

Chain C: 8 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	181-184	4
α-helix	186-196	11
β-strand	202-206	5	2
β-strand	209-213	5	2
α-helix	215-221	7
α-helix	223-230	8
α-helix	234-238	5
β-strand	240-243	4	2
α-helix	248-260	13
α-helix	266-279	14
α-helix	283-293	11

Chain D: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	25-45	21
α-helix	54-66	13
α-helix	70-83	14
α-helix	84-89	6
α-helix	90-94	5
α-helix	101-122	22
α-helix	124-125	2
α-helix	126-130	5
α-helix	136-138	3
α-helix	139-147	9
α-helix	148-152	5
α-helix	155-173	19
α-helix	180-192	13
α-helix	199-201	3
α-helix	202-206	5
α-helix	207-225	19
α-helix	230-250	21
α-helix	254-256	3
α-helix	257-268	12
α-helix	270-272	3
α-helix	273-278	6
α-helix	284-290	7
α-helix	294-303	10
α-helix	309-323	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	A, C	protein	145	Homo sapiens	O43791 (AlphaFold model)
Cullin-3	B, D	protein	364	Homo sapiens	Q13618 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4EOZ_1 Speckle-type POZ protein (chains A, C)
GSNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEME
ESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALC
SNLSVENAAEILILADLHSADQLKT

Sequence of entity 2 (B, D), FASTA

>4EOZ_2 Cullin-3 (chains B, D)
GSAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGL
REVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVE
NVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEG
RSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTE
EPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKLFSRVPNGLKTMCECM
SSYLREQGKALVSEEGEGKNPVDYRQGLDDLKSRFDRFLLESFNNDRLFKQTIAGDFEYF
LNLN

Primary citation

Adaptor protein self-assembly drives the control of a cullin-RING ubiquitin ligase. Errington, W.J., Khan, M.Q., Bueler, S.A. et al. Structure (2012) 20:1141-1153. DOI 10.1016/j.str.2012.04.009 · PubMed

Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IVV 1.25 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
7LIN 1.44 Å, X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide
7D3D 1.45 Å, Crystal structure of SPOP bound with a peptide
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
7LIP 1.48 Å, X-ray structure of SPOP MATH domain (D140G)
4HS2 1.53 Å, Crystal Structure of the Human SPOP C-terminal Domain
3HQL 1.66 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3HQM 1.74 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3IVB 1.75 Å, Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3…
6I5P 1.81 Å, Co-crystal structure of human SPOP MATH domain (E47K) and human BRD3 fragment
6I68 1.85 Å, Co-crystal structure of human SPOP MATH domain (M117V) and human BRD3 fragment
6I41 1.9 Å, Co-crystal structure of human SPOP MATH domain (wild-type) and human BRD3 fragment

Browse structure collections

About this viewer

MolViewer shows 4EOZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.