4ERN: PDB entry 4ERN

Crystal structure of the C-terminal domain of human XPB/ERCC-3 excision repair protein at 1.80 A. Determined by X-ray diffraction at 1.8 Å resolution. Released 30 Jan 2013.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,999
Mol. weight: 33.42 kDa
Released: 30 Jan 2013

Explore 4ERN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ERN contains 17 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	505-512	8	1
α-helix	513-515	3
α-helix	516-524	9
α-helix	528-530	3
α-helix	531-536	6
α-helix	538-552	15
β-strand	558-561	4	1
α-helix	565-574	10
β-strand	579-580	2	1
α-helix	586-598	13
β-strand	604-607	4	1
α-helix	609-611	3
α-helix	617-619	3
β-strand	620	1	2
β-strand	622-625	4	1
α-helix	633-643	11
β-strand	644	1	2
α-helix	646-647	2
β-strand	657-664	8	1
α-helix	668-670	3
α-helix	671-682	12
β-strand	686-690	5	1
α-helix	696-698	3
α-helix	706-718	13
α-helix	721-724	4
α-helix	726-728	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TFIIH basal transcription factor complex helicase XPB subunit	A	protein	289	Homo sapiens	P19447 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ERN_1 TFIIH basal transcription factor complex helicase XPB subunit (chains A)
MELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHER
RNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDT
SFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYS
TKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEF
GSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK

Primary citation

Structure of the C-terminal half of human XPB helicase and the impact of the disease-causing mutation XP11BE. Hilario, E., Li, Y., Nobumori, Y. et al. Acta Crystallogr D Biol Crystallogr (2013) 69:237-246. DOI 10.1107/S0907444912045040 · PubMed

Other PDB entries of the same protein (UniProt P19447 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NVV 2.9 Å, XPB-containing part of TFIIH in a post-translocated state (with ADP-BeF3)
28JM 3.29 Å, Cryo-EM structure of the human holo-TFIIH and XPC initial encounter complex
7EGB 3.3 Å, TFIID-based holo PIC on SCP promoter
8EBU 3.3 Å, XPC release from Core7-XPA-DNA (Cy5)
9PD3 3.3 Å, NER dual incision complex - DuIS
28JS 3.32 Å, Cryo-EM structure of the human holo-TFIIH-XPC complex bound to bulky lesion-mimic DNA…
9PD4 3.4 Å, NER dual incision complex - DuIM
6RO4 3.5 Å, Structure of the core TFIIH-XPA-DNA complex
7AD8 3.5 Å, Core TFIIH-XPA-DNA complex with modelled p62 subunit
9XYU 3.5 Å, NER complex - C7CAD.ATP
28KE 3.6 Å, Cryo-EM structure of the human holo-TFIIH-XPC-XPA complex bound to bulky lesion-mimic DNA
8EBX 3.6 Å, XPA repositioning Core7 of TFIIH relative to XPC-DNA lesion (AP)

Browse structure collections

About this viewer

MolViewer shows 4ERN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.