4F92: Brr2 Helicase Region S1087L

Brr2 Helicase Region S1087L. Determined by X-ray diffraction at 2.66 Å resolution. Released 17 Oct 2012.

Method: X-ray diffraction
Resolution: 2.66 Å
Organism: Homo sapiens
Chains: 1
Atoms: 14,019
Mol. weight: 197.44 kDa
Ligands: SAN
Released: 17 Oct 2012

Explore 4F92 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4F92 contains 95 α-helices and 71 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 95 helices, 71 β-strands

Element	Residues	Length	Sheet
α-helix	411-414	4
α-helix	419-421	3
β-strand	436-438	3	1
β-strand	442-445	4	1
β-strand	446-447	2	2
α-helix	448-455	8
β-strand	463	1	3
α-helix	469-471	3
β-strand	480	1	3
α-helix	483-487	5
α-helix	489-493	5
β-strand	499-502	4	4
α-helix	510-521	12
α-helix	522-524	3
β-strand	537-541	5	4
α-helix	545-559	15
β-strand	566-568	3	4
α-helix	580-582	3
β-strand	585-588	4	4
α-helix	590-596	7
α-helix	603-606	4
β-strand	609-614	6	4
α-helix	617-621	5
α-helix	625-642	18
β-strand	647-652	6	4
α-helix	658-664	7
α-helix	669-672	4
β-strand	673-675	3	4
α-helix	678-680	3
β-strand	685-688	4	2
β-strand	691-692	2	1
α-helix	697-712	16
β-strand	721-724	4	2
α-helix	732-744	13
α-helix	761-764	4
α-helix	772-777	6
β-strand	782-785	4	2
α-helix	792-802	11
β-strand	808-811	4	2
α-helix	813-818	6
β-strand	823	1	5
β-strand	825-829	5	2
β-strand	832-835	4	6
β-strand	840-843	4	6
α-helix	844-845	2
α-helix	846-853	8
β-strand	856	1	5
β-strand	865-870	6	2
β-strand	871-872	2	1
α-helix	878-882	5
α-helix	897-907	11
β-strand	912	1	7
α-helix	913-922	10
α-helix	924-931	8
α-helix	940-945	6
α-helix	950-966	17
β-strand	970-972	3	8
β-strand	978	1	7
β-strand	979-981	3	8
α-helix	983-990	8
α-helix	995-1004	10
α-helix	1011-1019	9
α-helix	1022-1024	3
α-helix	1031-1033	3
α-helix	1034-1043	10
α-helix	1055-1067	13
α-helix	1075-1101	27
β-strand	1104	1	9
α-helix	1105-1120	16
α-helix	1128-1131	4
α-helix	1137-1144	8
α-helix	1150-1155	6
α-helix	1158-1165	8
α-helix	1171-1178	8
β-strand	1184-1192	9	10
β-strand	1197-1206	10	10
β-strand	1218-1226	9	11
β-strand	1232	1	9
β-strand	1233-1242	10	11
α-helix	1243-1245	3
β-strand	1250-1257	8	10
β-strand	1265-1272	8	11
β-strand	1279-1285	7	11
α-helix	1291-1301	11
α-helix	1304-1307	4
β-strand	1308	1	12
α-helix	1309-1311	3
α-helix	1315-1318	4
β-strand	1327	1	12
α-helix	1330-1340	11
β-strand	1346-1349	4	13
α-helix	1357-1370	14
β-strand	1376-1379	4	13
α-helix	1383-1393	11
α-helix	1394-1400	7
β-strand	1405-1407	3	13
α-helix	1412-1421	10
β-strand	1424-1427	4	13
α-helix	1429-1436	8
α-helix	1443-1446	4
β-strand	1450-1453	4	13
α-helix	1456-1460	5
α-helix	1464-1479	16
α-helix	1485	1
β-strand	1486-1491	6	13
β-strand	1494	1	14
α-helix	1497-1504	8
β-strand	1511-1513	3	13
α-helix	1516-1518	3
β-strand	1523-1530	8	15
α-helix	1535-1540	6
α-helix	1543-1553	11
β-strand	1559-1563	5	15
α-helix	1566-1582	17
β-strand	1590	1	16
α-helix	1594-1601	8
α-helix	1607-1614	8
β-strand	1617-1620	4	15
α-helix	1626-1638	13
β-strand	1641	1	16
β-strand	1643-1647	5	15
α-helix	1648-1650	3
β-strand	1658	1	17
β-strand	1660-1664	5	15
β-strand	1667-1670	4	18
β-strand	1675-1678	4	18
α-helix	1679-1680	2
α-helix	1681-1688	8
β-strand	1691	1	17
β-strand	1700-1707	8	15
α-helix	1708-1710	3
α-helix	1711-1717	7
α-helix	1721	1
β-strand	1722	1	14
α-helix	1723	1
α-helix	1728-1730	3
α-helix	1733-1741	9
β-strand	1747	1	19
α-helix	1748-1755	8
α-helix	1760-1766	7
α-helix	1768-1770	3
α-helix	1778-1798	21
β-strand	1802-1805	4	19
β-strand	1809-1812	4	19
α-helix	1814-1821	8
α-helix	1826-1835	10
α-helix	1842-1850	9
α-helix	1853-1855	3
α-helix	1864-1874	11
α-helix	1887-1899	13
α-helix	1906-1932	27
β-strand	1935	1	20
α-helix	1936-1950	15
α-helix	1959-1962	4
α-helix	1968-1977	10
α-helix	1982-1986	5
α-helix	1990-1993	4
α-helix	2001-2013	13
β-strand	2017-2024	8	21
β-strand	2034-2043	10	21
α-helix	2050-2052	3
β-strand	2064-2070	7	20
β-strand	2075-2082	8	20
β-strand	2087-2095	9	21
β-strand	2102-2110	9	20
β-strand	2118-2124	7	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
U5 small nuclear ribonucleoprotein 200 kDa helicase	B	protein	1724	Homo sapiens	O75643 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>4F92_1 U5 small nuclear ribonucleoprotein 200 kDa helicase (chains B)
ALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQL
LPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREI
GKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEIS
ATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEM
TQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRF
QIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEV
LRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNL
PAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLS
LLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHD
DLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTY
NQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINV
LLQAFISQLKLEGFALMADMVYVTQLAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKR
MWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLF
PKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLL
KAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTEL
LDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAE
FAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGK
GNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQI
ERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLS
MAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYL
EKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLV
IIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEP
LPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHL
SDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTK
VRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSR
MQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLK
QLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSY
EVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKR
LTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVD

Ligands and cofactors

ID	Name	Formula	Copies
SAN	Sulfanilamide	C6 H8 N2 O2 S	1

Primary citation

Structural basis for functional cooperation between tandem helicase cassettes in Brr2-mediated remodeling of the spliceosome. Santos, K.F., Jovin, S.M., Weber, G. et al. Proc Natl Acad Sci U S A (2012) 109:17418-17423. DOI 10.1073/pnas.1208098109 · PubMed

Other PDB entries of the same protein (UniProt O75643 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Q0Z 2.0 Å, Crystal structure of Q9P172/Sec63 from Homo sapiens. Northeast Structural Genomics…
8BCE 2.05 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 76
8BC9 2.3 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 24
8BCC 2.35 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 39
8BCB 2.38 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 34
8BC8 2.39 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 18
8BCG 2.39 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 86
6S8Q 2.39 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1
9S2E 2.4 Å, Human intron-lariat spliceosome-Aquarius (ILSaqr)
8BCF 2.42 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 78
7BDK 2.52 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and ADP
7BDJ 2.59 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and mant-ATPgammaS

Browse structure collections

About this viewer

MolViewer shows 4F92 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.