Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at high pH. Determined by X-ray diffraction at 3.36 Å resolution. Released 1 Aug 2012.
Explore 4FZ1 in 3D Show helices and sheets RCSB PDB PDBe
4FZ1 contains 24 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 42-68 | 27 | |
| β-strand | 74-82 | 9 | 1 |
| β-strand | 86-87 | 2 | 2 |
| α-helix | 88-89 | 2 | |
| β-strand | 90-95 | 6 | 3 |
| α-helix | 106-111 | 6 | |
| α-helix | 135-140 | 6 | |
| α-helix | 155-162 | 8 | |
| α-helix | 166-169 | 4 | |
| β-strand | 170-175 | 6 | 1 |
| β-strand | 178-179 | 2 | 1 |
| α-helix | 182-184 | 3 | |
| β-strand | 185-190 | 6 | 3 |
| β-strand | 193-198 | 6 | 3 |
| α-helix | 205-208 | 4 | |
| β-strand | 209-210 | 2 | 2 |
| β-strand | 214-224 | 11 | 1 |
| α-helix | 227-229 | 3 | |
| α-helix | 230-232 | 3 | |
| β-strand | 246-251 | 6 | 3 |
| α-helix | 259-262 | 4 | |
| β-strand | 264-266 | 3 | 3 |
| β-strand | 270-282 | 13 | 1 |
| β-strand | 292 | 1 | 4 |
| α-helix | 306-322 | 17 | |
| β-strand | 325 | 1 | 5 |
| α-helix | 334 | 1 | |
| β-strand | 335 | 1 | 5 |
| α-helix | 338-340 | 3 | |
| α-helix | 341-345 | 5 | |
| α-helix | 346-350 | 5 | |
| α-helix | 351-355 | 5 | |
| α-helix | 363-364 | 2 | |
| β-strand | 365 | 1 | 4 |
| β-strand | 367-379 | 13 | 1 |
| α-helix | 386-392 | 7 | |
| α-helix | 397-403 | 7 | |
| β-strand | 404-411 | 8 | 1 |
| β-strand | 415-423 | 9 | 1 |
| α-helix | 427-430 | 4 | |
| α-helix | 431-435 | 5 | |
| α-helix | 436-449 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 6 |
| β-strand | 9 | 1 | 7 |
| β-strand | 17 | 1 | 6 |
| α-helix | 18 | 1 | |
| β-strand | 21-24 | 4 | 7 |
| β-strand | 32-35 | 4 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Acid-sensing ion channel 1 | A | protein | 450 | Gallus gallus | Q1XA76 (AlphaFold model) |
| Pi-theraphotoxin-Pc1a | D | protein | 40 | Psalmopoeus cambridgei | P60514 (AlphaFold model) |
>4FZ1_1 Acid-sensing ion channel 1 (chains A) GQPVSIQAFASSSTLHGISHIFSYERLSLKRVVWALCFMGSLALLALVCTNRIQYYFLYP HVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADE KQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYG KCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQ DEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDC ETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGK ELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGD IGGQMGLFIGASILTVLELFDYAYEVIKHR
>4FZ1_2 Pi-theraphotoxin-Pc1a (chains D) EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Structural plasticity and dynamic selectivity of acid-sensing ion channel-spider toxin complexes. Baconguis, I., Gouaux, E. Nature (2012) 489:400-405. DOI 10.1038/nature11375 · PubMed
Other PDB entries of the same protein (UniProt Q1XA76 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4FZ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.