4G8F: Clone42 TCR

Crystal Structure of clone42 TCR. Determined by X-ray diffraction at 2.1 Å resolution. Released 8 May 2013.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,654
Mol. weight: 49.96 kDa
Released: 8 May 2013

Explore 4G8F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4G8F contains 12 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	10-14	5	2
β-strand	19-24	6	1
β-strand	39-44	6	2
β-strand	51-56	6	2
β-strand	60-69	5	1
β-strand	79-84	6	1
β-strand	86-91	6	1
α-helix	96-98	3
β-strand	100-107	8	2
β-strand	115-117	3	2
α-helix	118	1
β-strand	121-126	6	2
α-helix	127	1
β-strand	135-141	7	3
β-strand	148-153	6	3
α-helix	162-164	3
β-strand	169-171	3	3
α-helix	172-174	3
β-strand	175-178	4	3
β-strand	185-193	9	3
α-helix	198-199	2

Chain B: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	4
β-strand	10-14	5	5
β-strand	19-25	7	4
β-strand	31-44	7	5
β-strand	51-56	6	5
β-strand	67-68	2	5
β-strand	77-79	3	4
β-strand	86-91	6	4
α-helix	96-98	3
β-strand	100-107	8	5
β-strand	116-117	2	5
β-strand	121-126	6	5
α-helix	129-131	3
β-strand	133	1	6
β-strand	136-141	6	3
α-helix	142-143	2
α-helix	144-150	7
β-strand	152-162	11	3
β-strand	163	1	6
β-strand	167-173	7	7
β-strand	176-178	3	7
β-strand	182-184	3	3
α-helix	188	1
β-strand	189-190	2	3
β-strand	200-209	10	3
α-helix	210-213	4
β-strand	219-226	8	7
β-strand	229	1	8
β-strand	243	1	8
β-strand	245-252	8	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
alpha chain clone 42 TCR	A	protein	204	Homo sapiens	P01848 (AlphaFold model)
beta chain clone 42 TCR	B	protein	243	Homo sapiens	P01850 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4G8F_1 alpha chain clone 42 TCR (chains A)
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRF
SSFLSRSKGYSYLLLKELQMKDSASYLCAVRNTGGFKTIFGAGTRLFVKANIQNPDPAVY
QLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSD
FACANAFNNSIIPEDTFFPSPESS

Sequence of entity 2 (B), FASTA

>4G8F_2 beta chain clone 42 TCR (chains B)
NAGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEV
PDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSPRLAGDEQFFGPGTRLTVLEDLKNVF
PPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQP
ALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWG
RAD

Primary citation

A conserved human T cell population targets mycobacterial antigens presented by CD1b. Van Rhijn, I., Kasmar, A., de Jong, A. et al. Nat Immunol (2013) 14:706-713. DOI 10.1038/ni.2630 · PubMed

Other PDB entries of the same protein (UniProt P01848 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UDT 1.35 Å, T cell receptor (TRAV22,TRBV7-9) structure
4WW1 1.38 Å, Crystal structure of human TCR Alpha Chain-TRAV21-TRAJ8 and Beta Chain-TRBV7-8
1OGA 1.4 Å, A structural basis for immunodominant human T-cell receptor recognition.
2BNU 1.4 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
1KGC 1.5 Å, Immune Receptor
2BNQ 1.7 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2BNR 1.9 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2IAL 1.92 Å, Structural basis for recognition of mutant self by a tumor-specific, MHC class…
5C0C 1.97 Å, 1E6 TCR in complex with HLA-A02 carrying RQFGPDWIVA
2VLM 1.98 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5KSA 2.0 Å, Bel602-DQ8.5-glia-gamma1 complex
7RYL 2.0 Å, T cell receptor CO3

Browse structure collections

About this viewer

MolViewer shows 4G8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.