4GEQ: Spc24-Spc25/Cnn1 binding interface

Crystal structure of the Spc24-Spc25/Cnn1 binding interface. Determined by X-ray diffraction at 2.01 Å resolution. Released 30 Jan 2013.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Saccharomyces cerevisiae S288c
Chains: 6
Atoms: 2,750
Mol. weight: 41.47 kDa
Released: 30 Jan 2013

Explore 4GEQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GEQ contains 14 α-helices and 14 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	134-145	12
β-strand	147-151	5	1
β-strand	158-163	6	1
β-strand	169-174	6	1
β-strand	181-185	5	1
α-helix	190-201	12
α-helix	206-220	15

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	157-167	11
β-strand	170-173	4	2
α-helix	174-176	3
β-strand	178-182	5	2
β-strand	189-193	5	2
α-helix	200-209	10

Chain D: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	156-167	12
β-strand	170-173	4	4
α-helix	174-176	3
β-strand	178-182	5	4
β-strand	189-193	5	4
α-helix	200-209	10

Chains E and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	63-78	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinetochore protein SPC25	A, C	protein	90	Saccharomyces cerevisiae S288c	P40014 (AlphaFold model)
Kinetochore protein SPC24	B, D	protein	66	Saccharomyces cerevisiae S288c	Q04477 (AlphaFold model)
Kinetochore-associated protein CNN1	E, F	protein	25	Saccharomyces cerevisiae S288c	P43618 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4GEQ_1 Kinetochore protein SPC25 (chains A, C)
MNDAAEVALYERLLQLRVLPGASDVHDVRFVFGDDSRCWIEVAMHGDHVIGNSHPALDPK
SRATLEHVLTVQGDLAAFLVVARDMLLASL

Sequence of entity 2 (B, D), FASTA

>4GEQ_2 Kinetochore protein SPC24 (chains B, D)
MANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
HHHHHH

Sequence of entity 3 (E, F), FASTA

>4GEQ_3 Kinetochore-associated protein CNN1 (chains E, F)
NKDPNEVRSFLQDLSQVLARKSQGN

Primary citation

A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors. Malvezzi, F., Litos, G., Schleiffer, A. et al. EMBO J (2013) 32:409-423. DOI 10.1038/emboj.2012.356 · PubMed

Other PDB entries of the same protein (UniProt P40014 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5T6J 1.75 Å, Structure of the MIND Complex Shows a Regulatory Focus of Yeast Kinetochore Assembly
2FTX 1.9 Å, Crystal structure of the yeast kinetochore Spc24/Spc25 globular domain
7KDF 2.72 Å, Structure of Stu2 Bound to dwarf Ndc80c
5TCS 2.83 Å, Crystal structure of a Dwarf Ndc80 Tetramer
8V10 3.02 Å, Structure of a Saccharomyces cerevisiae Mps1 peptide bound to dwarf Ndc80 Complex
8V11 3.95 Å, Structure of a Saccharomyces cerevisiae Ipl1 peptide Bound to dwarf Ndc80 complex
9S4Q 4.9 Å, Cryo-EM structure of the Saccharomyces cerevisiae KMN junction complex lacking the…
9S5N 7.2 Å, Cryo-EM structure of the Saccharomyces cerevisiae KMN junction complex containing the…
5TD8 7.53 Å, Crystal structure of an Extended Dwarf Ndc80 Complex
2FV4 NMR solution structure of the yeast kinetochore Spc24/Spc25 globular domain

Browse structure collections

About this viewer

MolViewer shows 4GEQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.