4GG8: Immune Receptor

Immune Receptor. Determined by X-ray diffraction at 3.2 Å resolution. Released 24 Oct 2012.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,153
Mol. weight: 101.88 kDa
Released: 24 Oct 2012

Explore 4GG8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GG8 contains 24 α-helices and 80 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and E: 3 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	16
β-strand	9-13	5	2
β-strand	18-23	6	16
α-helix	31	1
β-strand	32-38	7	2
β-strand	44-50	7	2
β-strand	55-56	2	16
β-strand	61-64	4	16
β-strand	70-75	6	16
α-helix	80-82	3
β-strand	85-91	7	2
β-strand	106-111	6	2
β-strand	120-123	4	17
β-strand	135-138	4	17
β-strand	154-156	3	17
α-helix	157-159	3
β-strand	160-162	3	17
β-strand	171-178	8	17
β-strand	199	1	17

Chains B and F: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	10
β-strand	10-14	5	11
β-strand	19-24	6	10
β-strand	31-38	8	11
β-strand	42-50	9	11
β-strand	53-54	2	11
β-strand	64-68	5	10
β-strand	74-78	5	10
α-helix	83-85	3
β-strand	87-94	8	11
β-strand	105-106	2	11
β-strand	110-115	6	11
α-helix	118-120	3
β-strand	122	1	12
α-helix	123-124	2
β-strand	125-129	5	13
α-helix	130-132	3
α-helix	133-139	7
β-strand	141-151	11	13
β-strand	152	1	12
β-strand	156-162	7	14
β-strand	165-167	3	14
β-strand	171-173	3	13
α-helix	177	1
β-strand	178-179	2	13
β-strand	189-198	10	13
α-helix	199-202	4
β-strand	208-215	8	14
β-strand	218	1	15
α-helix	229-230	2
β-strand	232	1	15
β-strand	234-241	8	14
α-helix	242-243	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-cell receptor, SP3.4 alpha chain	A, E	protein	207	Homo sapiens	K7N5N2 (AlphaFold model)
T-cell receptor, SP3.4 beta chain	B, F	protein	245	Homo sapiens	P01850 (AlphaFold model)

Sequence of entity 1 (A, E), FASTA

>4GG8_1 T-CELL RECEPTOR, SP3.4 ALPHA CHAIN (chains A, E)
MDAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRM
ASLAIAEDRKSSTLILHRATLRDAAVYYCILRDGRGGADGLTFGKGTHLIIQPYIQNPDP
AVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSN
KSDFACANAFNNSIIPEDTFFPSPESS

Sequence of entity 2 (B, F), FASTA

>4GG8_2 T-CELL RECEPTOR, SP3.4 BETA CHAIN (chains B, F)
DSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNI
LERFSAQQFPDLHSELNLSSLELGDSALYFCASSVAVSAGTYEQYFGPGTRLTVTEDLKN
VFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKE
QPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEA
WGRAD

Primary citation

Biased T cell receptor usage directed against human leukocyte antigen DQ8-restricted gliadin peptides is associated with celiac disease. Broughton, S.E., Petersen, J., Theodossis, A. et al. Immunity (2012) 37:611-621. DOI 10.1016/j.immuni.2012.07.013 · PubMed

Other PDB entries of the same protein (UniProt K7N5N2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AT6 1.42 Å, Crystal structure of the KFJ5 TCR
7N4K 1.85 Å, 6218 TCR in complex with H2-Db PA 224
7N5C 1.87 Å, 6218 TCR in complex with H2Db PA with an engineered TCR-pMHC disulfide bond
7N5P 2.09 Å, 6218 TCR in complex with H2-Db PA224-233 with a cysteine mutant
7M72 2.4 Å, MHC-like protein complex structure
6Q3S 2.5 Å, Engineered Human HLA_A2 MHC Class I molecule in complex with TCR and SV9 peptide
4Z7V 2.65 Å, L3-12 complex
4Z7U 2.7 Å, S13 complex
4MNQ 2.74 Å, TCR-peptide specificity overrides affinity enhancing TCR-MHC interactions
6PY2 2.83 Å, HLA-TCR complex
5WKF 2.95 Å, D30 TCR in complex with HLA-A*11:01-GTS1
3PQY 3.19 Å, Crystal Structure of 6218 TCR in complex with the H2Db-PA224

Browse structure collections

About this viewer

MolViewer shows 4GG8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.