4GQH: Capsid protein

The Conformations and Interactions of the Four-Layer Aggregate Revealed by X-ray Crystallography Diffraction Implied the Importance of Peptides at Opposite Ends in Their Assemblies. Determined by X-ray diffraction at 3.06 Å resolution. Released 28 Aug 2013.

Method: X-ray diffraction
Resolution: 3.06 Å
Organism: Tobacco mosaic virus
Chains: 34
Atoms: 36,918
Mol. weight: 657.92 kDa
Released: 28 Aug 2013

Explore 4GQH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GQH contains 234 α-helices and 264 β-strands across 34 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1-3	3	4
α-helix	7-13	7
β-strand	17-18	2	5
α-helix	20-30	11
α-helix	38-50	13
β-strand	53	1	5
β-strand	57	1	6
β-strand	60	1	6
β-strand	67-70	4	5
α-helix	77-86	10
α-helix	116-134	19
β-strand	138-140	3	5
α-helix	141-148	8
β-strand	151-153	3	4

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1-3	3	1
α-helix	4	1
α-helix	9-12	4
β-strand	17-18	2	2
α-helix	20-30	11
α-helix	38-50	13
β-strand	53	1	2
β-strand	57	1	3
β-strand	60	1	3
β-strand	68-70	3	2
α-helix	76-86	11
α-helix	110-134	25
β-strand	138-139	2	2
α-helix	141-148	8
β-strand	151-153	3	1

Chain b: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	9
α-helix	7-11	5
β-strand	17-18	2	10
α-helix	20-30	11
α-helix	38-50	13
β-strand	53	1	10
β-strand	68-70	3	10
α-helix	76-86	11
α-helix	115-133	19
β-strand	138-139	2	10
α-helix	141-148	8
β-strand	151-152	2	9

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1-3	3	7
α-helix	4	1
α-helix	7-13	7
β-strand	17-18	2	8
α-helix	20-30	11
α-helix	38-50	13
β-strand	53	1	8
β-strand	68-70	3	8
α-helix	77-86	10
α-helix	110-134	25
β-strand	138-139	2	8
α-helix	141-147	7
β-strand	151-153	3	7

Chain c: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1-3	3	14
α-helix	7-10	4
β-strand	17-18	2	15
α-helix	20-30	11
α-helix	38-50	13
β-strand	53	1	15
β-strand	57	1	16
β-strand	60	1	16
α-helix	61	1
α-helix	63	1
β-strand	67-70	4	15
α-helix	76-86	11
α-helix	117-133	17
β-strand	138-140	3	15
α-helix	141-148	8
β-strand	151-153	3	14

Chain C: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	11
α-helix	7-13	7
β-strand	17-18	2	12
α-helix	20-30	11
α-helix	38-50	13
β-strand	53	1	12
β-strand	57	1	13
β-strand	60	1	13
β-strand	68-70	3	12
α-helix	76-86	11
α-helix	112-133	22
β-strand	138-139	2	12
α-helix	141-148	8
β-strand	152	1	11

Chain d: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1-3	3	20
α-helix	4	1
α-helix	7-13	7
β-strand	17-18	2	21
α-helix	20-30	11
α-helix	38-50	13
β-strand	53	1	21
β-strand	57	1	22
β-strand	60	1	22
β-strand	68-70	3	21
α-helix	76-86	11
α-helix	115-134	20
β-strand	138-139	2	21
α-helix	141-148	8
β-strand	151-153	3	20

Chain D: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	17
α-helix	4	1
α-helix	9-12	4
β-strand	17-18	2	18
α-helix	20-30	11
α-helix	38-50	13
β-strand	53	1	18
β-strand	57	1	19
β-strand	60	1	19
α-helix	61-63	3
β-strand	68-70	3	18
α-helix	76-86	11
α-helix	108-112	5
α-helix	115-134	20
β-strand	138-139	2	18
α-helix	141-148	8
β-strand	151-152	2	17

26 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, h, i	protein	174	Tobacco mosaic virus	P69687

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, h, i), FASTA

>4GQH_1 Capsid protein (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, h, i)
MGSSHHHHHHSSGLVPRGSHSYSITTPSQFVFLSSAWADPIELINLCTNALGNQFQTQQA
RTVVQRQFSEVWKPSPQVTVRFPDSDFKVYRYNAVLDPLVTALLGAFDTRNRIIEVENQA
NPTTAETLDATRRVDDATVAIRSAINNLIVELIRGTGSYNRSSFESSSGLVWTS

Primary citation

The Conformations and Interactions of the Four-Layer Aggregate Revealed by X-ray Crystallography Diffraction Implied the Importance of Peptides at Opposite Ends in Their Assemblies. Li, X.Y., Song, B.A., Hu, D.Y. et al. To be published.

Other PDB entries of the same protein (UniProt P69687), best resolution first:

6SAE 1.9 Å, Cryo-EM structure of TMV in water
6R7M 1.92 Å, Tobacco Mosaic Virus (TMV)
6SAG 2.0 Å, Cryo-EM structure of TMV with Ca2+ at low pH
6I5A 2.3 Å, Tobacco Mosaic Virus
6RLP 2.3 Å, Cryo-EM reconstruction of TMV coat protein
1EI7 2.45 Å, Tmv coat protein refined from the 4-layer aggregate
8EAW 2.8 Å, An asymmetric disk assembly formed by tandem dimers of the tobacco mosaic viral capsid…
2TMV 2.9 Å, Visualization of protein-nucleic acid interactions in a virus. Refined structure of…
6X0Q 3.0 Å, A Circular Permutant of the Tobacco Mosaic Virus (TMV) mutant Q101H coordinated with heme
6X0R 3.0 Å, A Circular Permutant of the Tobacco Mosaic Virus (TMV) mutant Q101H
3KML 3.01 Å, Circular Permutant of the Tobacco Mosaic Virus
3J06 3.3 Å, CryoEM Helical Reconstruction of TMV

Browse structure collections

About this viewer

MolViewer shows 4GQH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.