4GXB: SNX17 atypical FERM domain

Structure of the SNX17 atypical FERM domain bound to the NPxY motif of P-selectin. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 Mar 2013.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 2,619
Mol. weight: 36.37 kDa
Released: 13 Mar 2013

Explore 4GXB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GXB contains 13 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	116-123	8	1
β-strand	128-134	7	1
α-helix	139-150	12
α-helix	154-159	6
β-strand	160-167	8	1
α-helix	168	1
β-strand	173-178	6	1
α-helix	179-180	2
α-helix	185-190	6
β-strand	197-203	7	1
α-helix	208-210	3
α-helix	211-214	4
α-helix	218-233	16
β-strand	238	1	2
α-helix	241-253	13
α-helix	256-263	8
β-strand	267	1	2
β-strand	272-273	2	3
β-strand	277-279	3	4
β-strand	286-288	3	4
β-strand	289-293	5	3
β-strand	296-300	5	3
β-strand	310-314	5	3
α-helix	315-317	3
β-strand	318-325	8	4
α-helix	326-328	3
β-strand	329	1	5
β-strand	343	1	5
β-strand	346-355	10	4
β-strand	358-365	8	4
α-helix	369-387	19

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	756-759	4	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-17	A	protein	280	Homo sapiens	Q15036 (AlphaFold model)
P-selectin	B	protein	41	Mus musculus	Q01102 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4GXB_1 Sorting nexin-17 (chains A)
NAQVPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREK
EDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQT
VSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPV
VVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVRLEL
AFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS

Sequence of entity 2 (B), FASTA

>4GXB_2 P-selectin (chains B)
GASAGSSKRLRKKDDGKCPLNPHSHLGTYGVFTNAAYDPTP

Primary citation

Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins. Ghai, R., Bugarcic, A., Liu, H. et al. Proc Natl Acad Sci U S A (2013) 110:E643-E652. DOI 10.1073/pnas.1216229110 · PubMed

Other PDB entries of the same protein (UniProt Q15036 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3LUI 1.8 Å, Crystal structure of the SNX17 PX domain with bound sulphate
3FOG 2.8 Å, Crystal structure of the PX domain of sorting nexin-17 (SNX17)
4TKN 3.0 Å, Structure of the SNX17 FERM domain bound to the second NPxF motif of KRIT1
9AU7 3.4 Å, Human Retriever VPS35L/VPS29/VPS26C complex bound to SNX17 peptide (Composite Map)
7RM8 Solution NMR structure of PDLIM7 PDZ bound to SNX17 peptide

Browse structure collections

About this viewer

MolViewer shows 4GXB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.