Structure of the SNX17 FERM domain bound to the second NPxF motif of KRIT1. Determined by X-ray diffraction at 3.0 Å resolution. Released 30 Jul 2014.
Explore 4TKN in 3D Show helices and sheets RCSB PDB PDBe
4TKN contains 40 α-helices and 52 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 116-122 | 7 | 1 |
| β-strand | 128-134 | 7 | 1 |
| α-helix | 139-150 | 12 | |
| α-helix | 154-159 | 6 | |
| β-strand | 160-167 | 8 | 1 |
| α-helix | 168 | 1 | |
| β-strand | 173-178 | 6 | 1 |
| α-helix | 179-180 | 2 | |
| α-helix | 185-190 | 6 | |
| β-strand | 197-203 | 7 | 1 |
| α-helix | 208-210 | 3 | |
| α-helix | 211-214 | 4 | |
| α-helix | 218-233 | 16 | |
| β-strand | 238 | 1 | 2 |
| α-helix | 241-253 | 13 | |
| α-helix | 257-263 | 7 | |
| β-strand | 267 | 1 | 2 |
| β-strand | 272-273 | 2 | 3 |
| β-strand | 277-279 | 3 | 4 |
| β-strand | 286-288 | 3 | 4 |
| β-strand | 289-293 | 5 | 3 |
| β-strand | 296-300 | 5 | 3 |
| β-strand | 310-314 | 5 | 3 |
| α-helix | 315-317 | 3 | |
| β-strand | 318-325 | 8 | 4 |
| β-strand | 346-355 | 10 | 4 |
| β-strand | 358-365 | 8 | 4 |
| α-helix | 369-387 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 116-122 | 7 | 5 |
| β-strand | 128-134 | 7 | 5 |
| α-helix | 139-150 | 12 | |
| α-helix | 154-159 | 6 | |
| β-strand | 160-167 | 8 | 5 |
| α-helix | 168 | 1 | |
| β-strand | 173-178 | 6 | 5 |
| α-helix | 179-180 | 2 | |
| α-helix | 185-190 | 6 | |
| β-strand | 197-203 | 7 | 5 |
| α-helix | 208-210 | 3 | |
| α-helix | 211-215 | 5 | |
| α-helix | 218-233 | 16 | |
| β-strand | 238 | 1 | 6 |
| β-strand | 239 | 1 | 7 |
| α-helix | 241-253 | 13 | |
| α-helix | 257-263 | 7 | |
| β-strand | 267 | 1 | 6 |
| β-strand | 272-273 | 2 | 8 |
| β-strand | 278-279 | 2 | 9 |
| β-strand | 289-293 | 5 | 8 |
| β-strand | 296-300 | 5 | 8 |
| β-strand | 311-314 | 4 | 8 |
| α-helix | 315-317 | 3 | |
| β-strand | 318-325 | 8 | 9 |
| β-strand | 346-355 | 10 | 9 |
| β-strand | 358-365 | 8 | 9 |
| α-helix | 369-387 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 116-122 | 7 | 10 |
| β-strand | 128-134 | 7 | 10 |
| α-helix | 139-150 | 12 | |
| α-helix | 154-159 | 6 | |
| β-strand | 160-167 | 8 | 10 |
| α-helix | 168 | 1 | |
| β-strand | 173-178 | 6 | 10 |
| α-helix | 179-180 | 2 | |
| α-helix | 185-190 | 6 | |
| β-strand | 197-203 | 7 | 10 |
| α-helix | 208-210 | 3 | |
| α-helix | 211-214 | 4 | |
| α-helix | 218-233 | 16 | |
| β-strand | 238 | 1 | 11 |
| β-strand | 239 | 1 | 7 |
| α-helix | 241-253 | 13 | |
| α-helix | 257-263 | 7 | |
| β-strand | 267 | 1 | 11 |
| β-strand | 272-273 | 2 | 12 |
| β-strand | 277-279 | 3 | 13 |
| β-strand | 286-288 | 3 | 13 |
| β-strand | 289-293 | 5 | 12 |
| β-strand | 296-300 | 5 | 12 |
| β-strand | 310-314 | 5 | 12 |
| α-helix | 315-317 | 3 | |
| β-strand | 318-325 | 8 | 13 |
| α-helix | 326-328 | 3 | |
| β-strand | 346-355 | 10 | 13 |
| β-strand | 358-365 | 8 | 13 |
| α-helix | 369-387 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 228 | 1 | |
| β-strand | 229-230 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sorting nexin-17 | A, B, C | protein | 286 | Homo sapiens | Q15036 (AlphaFold model) |
| Krev interaction trapped protein 1 | D, E, F | protein | 19 | Homo sapiens | O00522 (AlphaFold model) |
>4TKN_1 Sorting nexin-17 (chains A, B, C) GSETQQVPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLV REKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLY AQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKD CPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVR LELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKSGGS
>4TKN_2 Krev interaction trapped protein 1 (chains D, E, F) GPLGSPADTCIYNPLFGSD
Structural Determinants for Binding of Sorting Nexin 17 (SNX17) to the Cytoplasmic Adaptor Protein Krev Interaction Trapped 1 (KRIT1). Stiegler, A.L., Zhang, R., Liu, W. et al. J Biol Chem (2014) 289:25362-25373. DOI 10.1074/jbc.M114.584011 · PubMed
Other PDB entries of the same protein (UniProt Q15036 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4TKN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.