4HBD: KANK2 ankyrin repeats

Crystal structure of KANK2 ankyrin repeats. Determined by X-ray diffraction at 1.72 Å resolution. Released 12 Dec 2012.

Method: X-ray diffraction
Resolution: 1.72 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,107
Mol. weight: 30.16 kDa
Released: 12 Dec 2012

Explore 4HBD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HBD contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	592-606	15
α-helix	613-632	20
α-helix	638-651	14
α-helix	653-660	8
α-helix	670-676	7
α-helix	680-688	9
α-helix	704-707	4
α-helix	708-710	3
α-helix	716-728	13
α-helix	742-748	7
α-helix	752-760	9
α-helix	775-782	8
α-helix	785-792	8
α-helix	809-816	8
α-helix	819-828	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KN motif and ankyrin repeat domain-containing protein 2	A	protein	276	Homo sapiens	Q63ZY3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4HBD_1 KN motif and ankyrin repeat domain-containing protein 2 (chains A)
MGSSHHHHHHSSGRENLYFQGSGSNTEEEIRMELSPDLISACLALEKYLDNPNALTEREL
KVAYTTVLQEWLRLACRSDAHPELVRRHLVTFRAMSARLLDYVVNIADSNGNTALHYSVS
HANFPVVQQLLDSGVCKVDKQNRAGYSPIMLTALATLKTQDDIETVLQLFRLGNINAKAS
QAGQTALMLAVSHGRVDVVKALLACEADVNVQDDDGSTALMCACEHGHKEIAGLLLAVPS
CDISLTDRDGSTALMVALDAGQSEIASMLYSRMNIK

Primary citation

Crystal structure of KANK2 ankyrin repeats. Xu, C., Tempel, W., Cerovina, T. et al. To be published.

Other PDB entries of the same protein (UniProt Q63ZY3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TMD 1.5 Å, Crystal structure of KANK2 ankyrin repeats mutant (A670V)
5YBV 2.12 Å, The structure of the KANK2 ankyrin domain with the KIF21A peptide

Browse structure collections

About this viewer

MolViewer shows 4HBD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.