6TMD: KANK2 ankyrin repeats mutant

Crystal structure of KANK2 ankyrin repeats mutant (A670V). Determined by X-ray diffraction at 1.5 Å resolution. Released 16 Dec 2020.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,108
Mol. weight: 28.51 kDa
Released: 16 Dec 2020

Explore 6TMD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TMD contains 17 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	592-606	15
α-helix	613-623	11
α-helix	624-628	5
α-helix	629-631	3
α-helix	638-649	12
α-helix	653-660	8
α-helix	670-676	7
α-helix	680-688	9
α-helix	704-708	5
α-helix	716-728	13
α-helix	733-735	3
α-helix	742-748	7
α-helix	752-760	9
α-helix	775-782	8
α-helix	785-792	8
α-helix	809-815	7
α-helix	819-828	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KN motif and ankyrin repeat domain-containing protein 2	A	protein	256	Homo sapiens	Q63ZY3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6TMD_1 KN motif and ankyrin repeat domain-containing protein 2 (chains A)
GIDPFTEEEIRMELSPDLISACLALEKYLDNPNALTERELKVAYTTVLQEWLRLACRSDA
HPELVRRHLVTFRAMSARLLDYVVNIADSNGNTVLHYSVSHANFPVVQQLLDSGVCKVDK
QNRAGYSPIMLTALATLKTQDDIETVLQLFRLGNINAKASQAGQTALMLAVSHGRVDVVK
ALLACEADVNVQDDDGSTALMCACEHGHKEIAGLLLAVPSCDISLTDRDGSTALMVALDA
GQSEIASMLYSRMNIK

Primary citation

Crystal structure of KANK2 ankyrin repeats mutant (A670V). Khan, R., Singh, A.K., Goult, B.T. To be published.

Other PDB entries of the same protein (UniProt Q63ZY3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HBD 1.72 Å, Crystal structure of KANK2 ankyrin repeats
5YBV 2.12 Å, The structure of the KANK2 ankyrin domain with the KIF21A peptide

Browse structure collections

About this viewer

MolViewer shows 6TMD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.