5YBV: KANK2 ankyrin domain with the KIF21A peptide

The structure of the KANK2 ankyrin domain with the KIF21A peptide. Determined by X-ray diffraction at 2.12 Å resolution. Released 6 Dec 2017.

Method: X-ray diffraction
Resolution: 2.12 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,121
Mol. weight: 62.31 kDa
Released: 6 Dec 2017

Explore 5YBV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YBV contains 36 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	592-606	15
α-helix	608-610	3
α-helix	613-631	19
α-helix	638-651	14
α-helix	653-660	8
α-helix	670-676	7
α-helix	680-688	9
α-helix	704-707	4
α-helix	708-710	3
α-helix	716-727	12
α-helix	742-748	7
α-helix	752-760	9
α-helix	775-782	8
α-helix	785-792	8
α-helix	809-815	7
α-helix	819-828	10

Chain B: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	592-606	15
α-helix	608-610	3
α-helix	613-631	19
α-helix	638-649	12
α-helix	653-660	8
α-helix	670-676	7
α-helix	680-688	9
α-helix	704-707	4
α-helix	708-710	3
α-helix	716-728	13
α-helix	742-748	7
α-helix	752-760	9
α-helix	775-782	8
α-helix	785-792	8
α-helix	809-815	7
α-helix	819-828	10

Chains C and D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1153-1155	3
α-helix	1160-1164	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KN motif and ankyrin repeat domain-containing protein 2	A	protein	258	Homo sapiens	Q63ZY3 (AlphaFold model)
KN motif and ankyrin repeat domain-containing protein 2	B	protein	261	Homo sapiens	Q63ZY3 (AlphaFold model)
Kinesin-like protein KIF21A	C, D	protein	22	Homo sapiens	Q7Z4S6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5YBV_1 KN motif and ankyrin repeat domain-containing protein 2 (chains A)
GHMSGSNTEEEIRMELSPDLISACLALEKYLDNPNALTERELKVAYTTVLQEWLRLACRS
DAHPELVRRHLVTFRAMSARLLDYVVNIADSNGNTALHYSVSHANFPVVQQLLDSGVCKV
DKQNRAGYSPIMLTALATLKTQDDIETVLQLFRLGNINAKASQAGQTALMLAVSHGRVDV
VKALLACEADVNVQDDDGSTALMCACEHGHKEIAGLLLAVPSCDISLTDRDGSTALMVAL
DAGQSEIASMLYSRMNIK

Sequence of entity 2 (B), FASTA

>5YBV_2 KN motif and ankyrin repeat domain-containing protein 2 (chains B)
GHMGHMSGSNTEEEIRMELSPDLISACLALEKYLDNPNALTERELKVAYTTVLQEWLRLA
CRSDAHPELVRRHLVTFRAMSARLLDYVVNIADSNGNTALHYSVSHANFPVVQQLLDSGV
CKVDKQNRAGYSPIMLTALATLKTQDDIETVLQLFRLGNINAKASQAGQTALMLAVSHGR
VDVVKALLACEADVNVQDDDGSTALMCACEHGHKEIAGLLLAVPSCDISLTDRDGSTALM
VALDAGQSEIASMLYSRMNIK

Sequence of entity 3 (C, D), FASTA

>5YBV_3 Kinesin-like protein KIF21A (chains C, D)
EVKPKNKARRRTTTQMELLYAD

Primary citation

Structural basis for the recognition of kinesin family member 21A (KIF21A) by the ankyrin domains of KANK1 and KANK2 proteins. Guo, Q., Liao, S., Zhu, Z. et al. J Biol Chem (2018) 293:557-566. DOI 10.1074/jbc.M117.817494 · PubMed

Other PDB entries of the same protein (UniProt Q63ZY3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TMD 1.5 Å, Crystal structure of KANK2 ankyrin repeats mutant (A670V)
4HBD 1.72 Å, Crystal structure of KANK2 ankyrin repeats

Browse structure collections

About this viewer

MolViewer shows 5YBV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.