4HCP: Burkholderia pseudomallei effector protein chbp

crystal structure of Burkholderia pseudomallei effector protein chbp in complex with nedd8. Determined by X-ray diffraction at 2.52 Å resolution. Released 21 Nov 2012.

Method: X-ray diffraction
Resolution: 2.52 Å
Organisms: Burkholderia pseudomallei, Homo sapiens
Chains: 2
Atoms: 2,629
Mol. weight: 37.46 kDa
Released: 21 Nov 2012

Explore 4HCP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HCP contains 19 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	81-95	15
α-helix	99-106	8
α-helix	114-116	3
α-helix	119-132	14
α-helix	136-142	7
β-strand	154	1	1
α-helix	156-168	13
α-helix	176-178	3
α-helix	179-181	3
β-strand	182	1	2
α-helix	187-191	5
β-strand	199-206	8	2
β-strand	211-217	7	2
β-strand	228-230	3	2
β-strand	233	1	3
β-strand	242	1	3
α-helix	244-250	7
α-helix	258-264	7
α-helix	267-271	5
α-helix	274-285	12
α-helix	291-293	3
α-helix	296-298	3
β-strand	305-312	8	2
α-helix	314-325	12

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1-7	7	4
β-strand	12-17	6	4
β-strand	22	1	5
α-helix	23-34	12
α-helix	38-40	3
β-strand	42-45	4	4
β-strand	48-49	2	4
β-strand	55	1	5
α-helix	57-59	3
β-strand	66-70	5	4
β-strand	72	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Putative ATP/GTP binding protein	A	protein	255	Burkholderia pseudomallei	Q63KH5 (AlphaFold model)
NEDD8	B	protein	78	Homo sapiens	Q15843 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4HCP_1 Putative ATP/GTP binding protein (chains A)
SGRPLKHRVTLRKATLASLMQSLSGESSNRVMWNDRYDTLLIARDPREIKNAIEKSVTDF
GGLENYKELTGGADPFALMTPVAGLSANNIFKLMTEKDVPIDPTSIEYLENTSFAEHVNT
LDSHKNYVVIVNDGRLGHKFLIDLPALTQGPRTAYIIQSDLGGGALPAVRVEDWISRRGS
DPVSLDELNQLLSKDFSKMPDDVQTRLLASILQIDKDPHKVDIKKLHLDGKLRFASHEYD
FRQFQRNAQYVAGLG

Sequence of entity 2 (B), FASTA

>4HCP_2 NEDD8 (chains B)
AAMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAAD
YKILGGSVLHLVLALRGG

Primary citation

Structural mechanism of ubiquitin and NEDD8 deamidation catalyzed by bacterial effectors that induce macrophage-specific apoptosis. Yao, Q., Cui, J., Wang, J. et al. Proc Natl Acad Sci U S A (2012) 109:20395-20400. DOI 10.1073/pnas.1210831109 · PubMed

Other PDB entries of the same protein (UniProt Q63KH5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GQM 2.1 Å, Crystal structure of Cell Inhibiting Factor (Cif) from Burkholderia pseudomallei (CifBp)
3EIR 2.1 Å, Crystal structure of CHBP, a Cif Homologue from Burkholderia pseudomallei
3EIT 2.56 Å, the 2.6 angstrom crystal structure of CHBP, the Cif Homologue from Burkholderia…
4HCN 2.6 Å, Crystal structure of Burkholderia pseudomallei effector protein CHBP in complex with…

Browse structure collections

About this viewer

MolViewer shows 4HCP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.