4HCZ: PHF1 Tudor

PHF1 Tudor in complex with H3K36me3. Determined by X-ray diffraction at 1.85 Å resolution. Released 14 Nov 2012.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,222
Mol. weight: 15.47 kDa
Released: 14 Nov 2012

Explore 4HCZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HCZ contains 2 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	36-40	5	1
β-strand	46-55	10	1
β-strand	60-65	6	1
β-strand	70-74	5	1
α-helix	75-77	3
β-strand	78-80	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 1	A, B	protein	58	Homo sapiens	O43189 (AlphaFold model)
H3L-like histone	C, D	protein	10	Homo sapiens	Q6TXQ4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4HCZ_1 PHD finger protein 1 (chains A, B)
RPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPG

Sequence of entity 2 (C, D), FASTA

>4HCZ_2 H3L-like histone (chains C, D)
STGGVKKPHR

Primary citation

Molecular basis for H3K36me3 recognition by the Tudor domain of PHF1. Musselman, C.A., Avvakumov, N., Watanabe, R. et al. Nat Struct Mol Biol (2012) 19:1266-1272. DOI 10.1038/nsmb.2435 · PubMed

Other PDB entries of the same protein (UniProt O43189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WAV 1.7 Å, Crystal structure of PHF1 in complex with H3K36me3 substitution
6WAT 1.8 Å, complex structure of PHF1
7LKY 1.85 Å, Crystal Structure of PHF1 Tudor domain in complex with a peptidomimetic ligand UNC6641
5XFN 1.9 Å, Structure of the N-terminal domains of PHF1
5XFO 1.9 Å, Structure of the N-terminal domains of PHF1
5XFP 2.3 Å, Binary complex of PHF1 and a double stranded DNA
8H43 2.3 Å, Crystal structure of PHF1 Tudor domain in complex with hit 1
2E5P Solution structure of the TUDOR domain of PHD finger protein 1 (PHF1 protein)
2M0O The solution structure of human PHF1 in complex with H3K36me3

Browse structure collections

About this viewer

MolViewer shows 4HCZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.