4HDI: 3E5 IgG3 FAB from mus musculus

Crystal Structure of 3E5 IgG3 FAB from mus musculus. Determined by X-ray diffraction at 2.45 Å resolution. Released 17 Apr 2013.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Mus musculus
Chains: 4
Atoms: 6,742
Mol. weight: 95.86 kDa
Released: 17 Apr 2013

Explore 4HDI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HDI contains 30 α-helices and 90 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	12
β-strand	10-14	5	13
β-strand	19-25	7	12
β-strand	30	1	14
β-strand	36	1	14
β-strand	38-43	6	13
β-strand	49-54	6	13
β-strand	58-59	2	13
α-helix	60	1
β-strand	67-72	6	12
β-strand	75-80	6	12
α-helix	85-87	3
β-strand	89-95	7	13
β-strand	102-103	2	13
β-strand	107-112	6	13
β-strand	116	1	15
α-helix	117-118	2
β-strand	119-123	5	16
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	16
β-strand	145	1	15
β-strand	150-155	6	17
β-strand	158-160	3	17
β-strand	164-168	5	16
α-helix	169-172	4
β-strand	178-187	10	16
α-helix	188-192	5
β-strand	196-202	7	17
α-helix	209	1
β-strand	210-215	6	17

Chain B: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	18
β-strand	11-12	2	19
β-strand	18-25	8	18
α-helix	29-31	3
β-strand	34-39	6	20
β-strand	45-51	7	20
β-strand	58-59	2	20
α-helix	62-64	3
β-strand	69-73	5	18
β-strand	78-83	6	18
α-helix	88-90	3
β-strand	92-99	8	20
α-helix	100	1
β-strand	107-110	4	20
β-strand	114-116	3	20
β-strand	117-118	2	19
β-strand	124	1	21
β-strand	127-131	5	22
β-strand	142-152	11	22
β-strand	153	1	21
β-strand	158-161	4	23
α-helix	162-164	3
β-strand	166	1	23
β-strand	170-172	3	22
α-helix	173-175	3
β-strand	176-178	3	22
β-strand	181-191	11	22
β-strand	201-206	6	23
α-helix	207-209	3
β-strand	211-216	6	23

Chain H: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	45-51	7	8
β-strand	58-59	2	8
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-99	8	8
β-strand	107-110	4	8
β-strand	114-118	5	8
β-strand	124	1	9
β-strand	127-131	5	10
β-strand	143-152	10	10
β-strand	153	1	9
β-strand	158-161	4	11
α-helix	162-164	3
β-strand	171-172	2	10
α-helix	173-175	3
β-strand	176-178	3	10
β-strand	181-190	10	10
α-helix	192-194	3
β-strand	200-206	7	11
α-helix	207-209	3
β-strand	211-217	7	11

Chain L: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	49-54	6	2
β-strand	58-59	2	2
α-helix	60	1
β-strand	67-72	6	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-112	6	2
β-strand	116	1	4
α-helix	117-118	2
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	150-155	6	6
β-strand	158-160	3	6
β-strand	164-168	5	5
α-helix	169-172	4
β-strand	178-187	10	5
α-helix	188-191	4
β-strand	196-202	7	6
β-strand	210-215	6	6
α-helix	216-218	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kappa light chain variable region, Anti-colorectal carcinoma light chain	A, L	protein	219	Mus musculus	A2NHM3 (AlphaFold model)
Ig heavy chain V region RF, Ig gamma-3 chain C region	B, H	protein	220	Mus musculus	P84751 (AlphaFold model)

Sequence of entity 1 (A, L), FASTA

>4HDI_1 Kappa light chain variable region, Anti-colorectal carcinoma light chain (chains A, L)
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVANRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (B, H), FASTA

>4HDI_2 Ig heavy chain V region RF, Ig gamma-3 chain C region (chains B, H)
DVKLVESGGGLVKLGGSLKLSCAASGFTFSNYFMSWVRQTPEKRLELVAVITSNGDNTYY
PDTVKGRFTISRDNAQNTLYLQMSSLKSEDTALYYCARRDSSASLYFDYWGQGTTLTVSS
ATTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSG
FYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR

Primary citation

Global structures of IgG isotypes expressing identical variable regions. Eryilmaz, E., Janda, A., Kim, J. et al. Mol Immunol (2013) 56:588-598. DOI 10.1016/j.molimm.2013.06.006 · PubMed

Other PDB entries of the same protein (UniProt A2NHM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PXR 1.56 Å, Anti-TAU BIIB092 FAB with TAU peptide
4TPR 1.6 Å, Structure of Tau5 antibody Fab fragment
4TQE 1.6 Å, Structure of tau peptide in complex with Tau5 antibody Fab fragment
3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2DQU 1.7 Å, Crystal form II: high resolution crystal structure of the complex of the hydrolytic…
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
1ZEA 1.78 Å, Structure of the anti-cholera toxin antibody Fab fragment TE33 in complex with a D-peptide
1PZ5 1.8 Å, Structural basis of peptide-carbohydrate mimicry in an antibody combining site
2DQT 1.8 Å, High resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and…

Browse structure collections

About this viewer

MolViewer shows 4HDI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.