4HJ0: Human GIPr ECD
Crystal structure of the human GIPr ECD in complex with Gipg013 Fab at 3-A resolution. Determined by X-ray diffraction at 3.0 Å resolution. Released 29 May 2013.
- Method
- X-ray diffraction
- Resolution
- 3.0 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 7,635
- Mol. weight
- 124.43 kDa
- Released
- 29 May 2013
Explore 4HJ0 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4HJ0 contains 27 α-helices and 93 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 8 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 32-42 | 11 | |
| α-helix | 46-52 | 7 | |
| α-helix | 53-56 | 4 | |
| β-strand | 61 | 1 | 1 |
| α-helix | 62-63 | 2 | |
| β-strand | 64-65 | 2 | 2 |
| β-strand | 70-71 | 2 | 2 |
| β-strand | 74 | 1 | 1 |
| β-strand | 79-83 | 5 | 3 |
| α-helix | 84-85 | 2 | |
| α-helix | 91-94 | 4 | |
| β-strand | 98-103 | 6 | 3 |
| α-helix | 104 | 1 | |
| α-helix | 108 | 1 | |
| β-strand | 109-114 | 6 | 3 |
Chain B: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 32-51 | 20 | |
| α-helix | 61-63 | 3 | |
| β-strand | 65 | 1 | 4 |
| β-strand | 70 | 1 | 4 |
| β-strand | 79-83 | 5 | 5 |
| α-helix | 84-85 | 2 | |
| α-helix | 91-94 | 4 | |
| β-strand | 98-102 | 5 | 5 |
| β-strand | 114 | 1 | 5 |
Chain C: 3 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6 | 1 | 23 |
| β-strand | 10-12 | 3 | 24 |
| β-strand | 18-23 | 6 | 23 |
| β-strand | 34-39 | 6 | 24 |
| β-strand | 45-51 | 7 | 24 |
| β-strand | 68-73 | 6 | 23 |
| β-strand | 78-83 | 6 | 23 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-97 | 6 | 24 |
| α-helix | 105-106 | 2 | |
| β-strand | 109 | 1 | 24 |
| β-strand | 113-117 | 5 | 24 |
| β-strand | 126-129 | 4 | 25 |
| β-strand | 141-151 | 11 | 25 |
| β-strand | 157-160 | 4 | 26 |
| β-strand | 169-176 | 8 | 25 |
| β-strand | 182-191 | 10 | 25 |
| β-strand | 201-206 | 6 | 26 |
| α-helix | 207-209 | 3 | |
| β-strand | 211-216 | 6 | 26 |
Chain D: 5 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5 | 1 | 19 |
| β-strand | 9-11 | 3 | 20 |
| β-strand | 18-22 | 5 | 19 |
| β-strand | 34-39 | 6 | 20 |
| α-helix | 44-45 | 2 | |
| β-strand | 46-49 | 4 | 20 |
| β-strand | 64-65 | 2 | 19 |
| β-strand | 72-76 | 5 | 19 |
| α-helix | 81-83 | 3 | |
| β-strand | 86-92 | 7 | 20 |
| β-strand | 99-101 | 3 | 20 |
| β-strand | 106-108 | 3 | 20 |
| α-helix | 114-116 | 3 | |
| β-strand | 118-121 | 4 | 21 |
| α-helix | 125-130 | 6 | |
| β-strand | 133-139 | 7 | 21 |
| β-strand | 148-152 | 5 | 22 |
| β-strand | 158 | 1 | 22 |
| β-strand | 163-164 | 2 | 21 |
| β-strand | 178-183 | 6 | 21 |
| α-helix | 185-188 | 4 | |
| β-strand | 195-199 | 5 | 22 |
Chain P: 3 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4 | 1 | 6 |
| β-strand | 5-6 | 2 | 7 |
| β-strand | 10-12 | 3 | 8 |
| β-strand | 18-23 | 6 | 7 |
| β-strand | 33-39 | 7 | 8 |
| β-strand | 45-51 | 7 | 8 |
| β-strand | 68-70 | 3 | 7 |
| β-strand | 78-83 | 6 | 7 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-99 | 8 | 8 |
| β-strand | 108 | 1 | 8 |
| β-strand | 110 | 1 | 6 |
| β-strand | 113-117 | 5 | 8 |
| α-helix | 120-122 | 3 | |
| β-strand | 123 | 1 | 9 |
| β-strand | 126-129 | 4 | 10 |
| β-strand | 142-151 | 10 | 10 |
| β-strand | 152 | 1 | 9 |
| β-strand | 157-160 | 4 | 11 |
| β-strand | 169-171 | 3 | 10 |
| α-helix | 172-174 | 3 | |
| β-strand | 175-176 | 2 | 10 |
| β-strand | 182-190 | 9 | 10 |
| β-strand | 201-206 | 6 | 11 |
| β-strand | 211-216 | 6 | 11 |
Chain Q: 4 helices, 25 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3 | 1 | 12 |
| α-helix | 4 | 1 | |
| β-strand | 5 | 1 | 13 |
| β-strand | 9-10 | 2 | 14 |
| β-strand | 18-23 | 6 | 13 |
| β-strand | 35-39 | 5 | 14 |
| β-strand | 45-49 | 5 | 14 |
| β-strand | 50 | 1 | 15 |
| β-strand | 54 | 1 | 15 |
| β-strand | 63-65 | 3 | 13 |
| β-strand | 71-76 | 6 | 13 |
| β-strand | 86-91 | 6 | 14 |
| β-strand | 100-101 | 2 | 14 |
| β-strand | 102 | 1 | 12 |
| β-strand | 105-107 | 3 | 14 |
| β-strand | 117-121 | 5 | 16 |
| α-helix | 122-124 | 3 | |
| α-helix | 125-128 | 4 | |
| β-strand | 133-140 | 8 | 16 |
| β-strand | 148-153 | 6 | 17 |
| β-strand | 158 | 1 | 17 |
| β-strand | 162-164 | 3 | 16 |
| β-strand | 168-170 | 3 | 16 |
| β-strand | 174-183 | 10 | 16 |
| α-helix | 185-189 | 5 | |
| β-strand | 193 | 1 | 18 |
| β-strand | 194-199 | 6 | 17 |
| β-strand | 206-209 | 4 | 17 |
| β-strand | 212 | 1 | 18 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Gastric inhibitory polypeptide receptor | A, B | protein | 136 | Homo sapiens | P48546 (AlphaFold model) |
| Gipg013 Fab, Antagonizing antibody to the GIP Receptor, Heavy chain | C, P | protein | 227 | Homo sapiens | |
| Gipg013 Fab, Antagonizing antibody to the GIP Receptor, Light chain | D, Q | protein | 215 | Homo sapiens | |
Sequence of entity 1 (A, B), FASTA
>4HJ0_1 Gastric inhibitory polypeptide receptor (chains A, B)
MGSSHHHHHHSDYKDDDDKHMETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACN
GSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPE
KNEAFLDQRLILERLQ
Sequence of entity 2 (C, P), FASTA
>4HJ0_2 Gipg013 Fab, Antagonizing antibody to the GIP Receptor, Heavy chain (chains C, P)
QVQLQQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPTFGTANY
AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAQGPIVGAPTDYWGKGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHT
Sequence of entity 3 (D, Q), FASTA
>4HJ0_3 Gipg013 Fab, Antagonizing antibody to the GIP Receptor, Light chain (chains D, Q)
SYVLTQPPSASGTPGQRVAISCSGSNSNIGSNTVHWYQQLPGAAPKLLIYSNNQRPSGVP
DRFSGSNSGTSASLAISRLQSEDEADYYCAAWDDSLNGVVFGGGTKVTVLQPKAAPSVTL
FPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSY
LSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Primary citation
Structural and Pharmacological Characterization of Novel Potent and Selective Monoclonal Antibody Antagonists of Glucose-dependent Insulinotropic Polypeptide Receptor. Ravn, P., Madhurantakam, C., Kunze, S. et al. J Biol Chem (2013) 288:19760-19772. DOI 10.1074/jbc.M112.426288 · PubMed
Other PDB entries of the same protein (UniProt P48546 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2QKH 1.9 Å, Crystal structure of the extracellular domain of human GIP receptor in complex with the…
- 6DKJ 1.95 Å, human GIPR ECD and Fab complex
- 9XN3 2.74 Å, Glucose-dependent insulinotropic polypeptide receptor-Gs complex activated by the small…
- 8WA3 2.86 Å, Cryo-EM structure of peptide free and Gs-coupled GIPR
- 7DTY 2.98 Å, Structural basis of ligand selectivity conferred by the human glucose-dependent…
- 7RBT 3.08 Å, cryo-EM structure of human Gastric inhibitory polypeptide receptor GIPR bound to…
- 7FIN 3.1 Å, Cryo-EM structure of the GIPR/GLP-1R/GCGR triagonist peptide 20-bound human GIPR-Gs…
- 8ITM 3.13 Å, Cryo-EM structure of GIPR splice variant 2 (SV2) in complex with Gs protein
- 7VAB 3.2 Å, Cryo-EM structure of the non-acylated tirzepatide (LY3298176)-bound human GIPR-Gs complex
- 8ITL 3.23 Å, Cryo-EM structure of GIPR splice variant 1 (SV1) in complex with Gs protein
- 7RA3 3.24 Å, cryo-EM of human Gastric inhibitory polypeptide receptor GIPR bound to GIP
- 8YW4 3.26 Å, Cryo-EM structure of the retatrutide-bound human GIPR-Gs complex
Browse structure collections
About this viewer
MolViewer shows 4HJ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.