4HPL: PCGF1 Ub fold (RAWUL)/BCOR PUFD Complex

PCGF1 Ub fold (RAWUL)/BCOR PUFD Complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 1 May 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,691
Mol. weight: 24.75 kDa
Released: 1 May 2013

Explore 4HPL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HPL contains 13 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1637-1642	6	1
α-helix	1645-1649	5
β-strand	1650-1653	4	2
β-strand	1660-1665	6	2
α-helix	1666-1673	8
α-helix	1677-1683	7
β-strand	1689-1693	5	2
α-helix	1694-1702	9
α-helix	1705-1707	3
α-helix	1710-1712	3
β-strand	1723-1728	6	2
α-helix	1731-1736	6
β-strand	1740-1744	5	1

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	166-167	2
β-strand	168-175	8	1
β-strand	191-195	5	1
β-strand	199	1	3
α-helix	200-211	12
β-strand	219-222	4	1
β-strand	225-226	2	1
α-helix	227-228	2
β-strand	232	1	3
α-helix	233-236	4
α-helix	237-241	5
α-helix	245	1
β-strand	248-253	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BCL-6 corepressor	A	protein	119	Homo sapiens	Q6W2J9 (AlphaFold model)
Polycomb group RING finger protein 1	B	protein	93	Homo sapiens	Q9BSM1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4HPL_1 BCL-6 corepressor (chains A)
METRSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEI
VTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSD

Sequence of entity 2 (B), FASTA

>4HPL_2 Polycomb group RING finger protein 1 (chains B)
QGTREQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLF
DNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVK

Primary citation

Structure of the Polycomb Group Protein PCGF1 in Complex with BCOR Reveals Basis for Binding Selectivity of PCGF Homologs. Junco, S.E., Wang, R., Gaipa, J.C. et al. Structure (2013) 21:665-671. DOI 10.1016/j.str.2013.02.013 · PubMed

Other PDB entries of the same protein (UniProt Q6W2J9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HCU 2.2 Å, Crystal structure of BCOR/PCGF1/KDM2B complex
3BIM 2.6 Å, Crystal structure of the BCL6 BTB domain dimer in complex with the BCOR BBD corepressor…
2N1L Solution structure of the BCOR PUFD
6B7G Solution NMR structure of BCoR in complex with AF9 (BCoR-AF9)

Browse structure collections

About this viewer

MolViewer shows 4HPL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.