Crystal structure of the T98D c-Src-SH3 domain mutant in complex with the high affinity peptide APP12. Determined by X-ray diffraction at 0.98 Å resolution. Released 1 May 2013.
Explore 4HVU in 3D Show helices and sheets RCSB PDB PDBe
4HVU contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 86-88 | 3 | 1 |
| β-strand | 92 | 1 | 2 |
| β-strand | 99 | 1 | 1 |
| β-strand | 102 | 1 | 2 |
| β-strand | 107-112 | 6 | 1 |
| β-strand | 118-123 | 6 | 1 |
| β-strand | 129-133 | 5 | 1 |
| α-helix | 134-136 | 3 | |
| β-strand | 137-139 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-9 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Proto-oncogene tyrosine-protein kinase Src | A | protein | 61 | Gallus gallus | P00523 (AlphaFold model) |
| SYNTHETIC PEPTIDE Acetyl-APPLPPRNRP | B | protein | 11 |
>4HVU_1 Proto-oncogene tyrosine-protein kinase Src (chains A) GSHMTFVALYDYESRTEDDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS D
>4HVU_2 SYNTHETIC PEPTIDE Acetyl-APPLPPRNRP (chains B) XAPPLPPRNRP
| ID | Name | Formula | Copies |
|---|---|---|---|
| ACE | Acetyl group | C2 H4 O | 2 |
Water and common crystallization additives (SO4) are not listed.
Atomic resolution structures of the c-Src SH3 domain in complex with two high-affinity peptides from classes I and II. Bacarizo, J., Camara-Artigas, A. Acta Crystallogr D Biol Crystallogr (2013) 69:756-766. DOI 10.1107/S0907444913001522 · PubMed
Other PDB entries of the same protein (UniProt P00523 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4HVU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.