5OAV: C-Src-SH3 domain mutant E93V

High resolution crystal structure of the c-Src-SH3 domain mutant E93V in complex with the high affinity synthetic peptide APP12: monoclinic crystal. Determined by X-ray diffraction at 0.95 Å resolution. Released 12 Jul 2017.

Method: X-ray diffraction
Resolution: 0.95 Å
Organisms: Gallus gallus, synthetic construct
Chains: 4
Atoms: 1,243
Mol. weight: 16.63 kDa
Released: 12 Jul 2017

Explore 5OAV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5OAV contains 4 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	86-88	3	1
β-strand	92	1	2
β-strand	99	1	1
β-strand	102	1	2
β-strand	107-112	6	1
β-strand	118-123	6	1
β-strand	129-133	5	1
α-helix	134-136	3
β-strand	137-139	3	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5

Chain C: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	86-88	3	3
β-strand	92	1	4
β-strand	99	1	3
β-strand	102	1	4
β-strand	107-110	4	3
β-strand	118-123	6	3
β-strand	129-133	5	3
α-helix	134-136	3
β-strand	137-139	3	3

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-10	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proto-oncogene tyrosine-protein kinase Src	A, C	protein	61	Gallus gallus	P00523 (AlphaFold model)
APP12	B, D	protein	13	synthetic construct

Sequence of entity 1 (A, C), FASTA

>5OAV_1 Proto-oncogene tyrosine-protein kinase Src (chains A, C)
GSHMTFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
D

Sequence of entity 2 (B, D), FASTA

>5OAV_2 APP12 (chains B, D)
XAPPLPPRNRPRL

Primary citation

High resolution crystal structure of the c-Src-SH3 domain mutant E93V in complex with the high affinity synthetic peptide APP12: monoclinic crystal. Camara-Artigas, A. To be published.

Other PDB entries of the same protein (UniProt P00523 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XVM 0.9 Å, Crystal structure of c-Src SH3 domain without ATCUN motif: monomer 2
7A31 0.94 Å, Crystal structure of the c-Src SH3 domain mutant S94A-T98D-V111L-N113S-T114S at pH 4.5
7A33 0.96 Å, Crystal structure of the c-Src SH3 domain mutant S94A-T98D-V111L-N113S-T114S at pH 3.0
4RTZ 0.98 Å, Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide VSL12
4HVU 0.98 Å, Crystal structure of the T98D c-Src-SH3 domain mutant in complex with the high affinity…
4HVW 0.98 Å, Crystal structure of the T98E c-Src-SH3 domain mutant in complex with the high affinity…
4OMO 1.04 Å, Crystal structure of the c-Src tyrosine kinase SH3 domain mutant Q128E
6XX4 1.05 Å, Crystal structure of the c-Src SH3 domain H122R-Q128E mutant in complex with Ni(II) at…
4HVV 1.1 Å, Crystal structure of the T98E c-Src-SH3 domain mutant in complex with the high affinity…
7A32 1.15 Å, Crystal structure of the c-Src SH3 domain mutant S94A-T98D-V111L-N113S-T114S at pH 7.0
5ECA 1.16 Å, Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from…
5OB0 1.17 Å, Crystal structure of the c-Src-SH3 domain Q128E mutant in complex with the high affinity…

Browse structure collections

About this viewer

MolViewer shows 5OAV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.