4HZ3: MthK pore crystallized in presence of TBSb

MthK pore crystallized in presence of TBSb. Determined by X-ray diffraction at 1.7 Å resolution. Released 26 Dec 2012.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Methanothermobacter thermautotrophicus
Chains: 8
Atoms: 5,608
Mol. weight: 83.9 kDa
Ligands: HEZ
Released: 26 Dec 2012

Explore 4HZ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HZ3 contains 24 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G and H: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	20-42	23
α-helix	46-57	12
α-helix	70-98	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-gated potassium channel mthK	A, B, C, D, E, F, G, H	protein	91	Methanothermobacter thermautotrophicus	O27564 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>4HZ3_1 Calcium-gated potassium channel mthK (chains A, B, C, D, E, F, G, H)
HLPRVLKVPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTP
LGMYFTCTLIVLGIGTFAVAVERLLEFLINR

Ligands and cofactors

ID	Name	Formula	Copies
HEZ	Hexane-1,6-diol	C6 H14 O2	20

Water and common crystallization additives (K) are not listed.

Primary citation

The voltage-dependent gate in MthK potassium channels is located at the selectivity filter. Posson, D.J., McCoy, J.G., Nimigean, C.M. Nat Struct Mol Biol (2013) 20:159-166. DOI 10.1038/nsmb.2473 · PubMed

Other PDB entries of the same protein (UniProt O27564 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3LDC 1.45 Å, High resolution open MthK pore structure crystallized in 100 mM K+
3LDD 1.45 Å, High resolution open MthK pore structure crystallized in 100 mM K+ and further soaked in…
6U9T 1.55 Å, Wild-type MthK pore in 50 mM K+
4HYO 1.65 Å, Crystal Structure of MthK Pore
6U9P 1.65 Å, Wild-type MthK pore in ~150 mM K+
2AEF 1.7 Å, Crystal Structures of the MthK RCK Domain in Ca2+ bound form
3OUS 1.75 Å, MthK channel pore T59A mutant
3R65 1.8 Å, MthK channel pore E92Q mutant
6U9Y 1.8 Å, Wild-type MthK pore in 11 mM K+
4L74 1.84 Å, Ca2+-bound MthK RCK domain at 1.9 Angstrom with single ligand
6U9Z 1.95 Å, Wild-type MthK pore in 6 mM K+
2AEJ 2.1 Å, Crystal Structures of the MthK RCK Domain in no Ca2+ bound form

Browse structure collections

About this viewer

MolViewer shows 4HZ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.