4I2Y: Genetically encoded calcium indicator RGECO1

Crystal Structure of the genetically encoded calcium indicator RGECO1. Determined by X-ray diffraction at 2.2 Å resolution. Released 24 Jul 2013.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Gallus gallus, Discosoma sp., Rattus norvegicus
Chains: 2
Atoms: 6,199
Mol. weight: 95.38 kDa
Ligands: CA
Released: 24 Jul 2013

Explore 4I2Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4I2Y contains 34 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	40-56	17
α-helix	59-61	3
β-strand	63-68	6	1
β-strand	71-76	6	1
β-strand	79-82	4	2
β-strand	87-88	2	2
β-strand	90-98	9	1
α-helix	103-106	4
β-strand	108-119	12	1
β-strand	125-135	11	1
β-strand	169-179	11	1
β-strand	182-193	12	1
β-strand	198-207	10	1
α-helix	209	1
α-helix	211	1
α-helix	215-217	3
α-helix	219-221	3
α-helix	227-229	3
β-strand	231	1	1
α-helix	239-242	4
β-strand	248-256	9	1
β-strand	261-271	11	1
β-strand	274-284	11	1
β-strand	297-301	5	2
β-strand	304	1	3
α-helix	305-308	4
α-helix	309-322	14
β-strand	329-330	2	4
α-helix	332-341	10
α-helix	348-358	11
β-strand	366-367	2	4
α-helix	368-375	8
β-strand	377	1	3
α-helix	381-395	15
β-strand	402-403	2	5
α-helix	405-415	11
α-helix	421-431	11
β-strand	439-440	2	5
α-helix	441-447	7

Chain B: 16 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	42-57	16
α-helix	59-61	3
β-strand	63-68	6	6
β-strand	71-76	6	6
β-strand	79-82	4	7
β-strand	87-88	2	7
β-strand	90-98	9	6
β-strand	108-119	12	6
β-strand	125-135	11	6
β-strand	169-179	11	6
β-strand	182-193	12	6
β-strand	198-207	10	6
α-helix	209	1
α-helix	211	1
α-helix	215-217	3
α-helix	219-221	3
β-strand	231	1	6
α-helix	239-242	4
β-strand	248-256	9	6
β-strand	261-271	11	6
β-strand	274-284	11	6
β-strand	297-301	5	7
β-strand	304	1	8
α-helix	305-308	4
α-helix	309-322	14
β-strand	329	1	9
α-helix	332-341	10
α-helix	348-358	11
β-strand	367	1	9
α-helix	368-376	9
β-strand	377	1	8
α-helix	381-395	15
β-strand	402-403	2	10
α-helix	405-415	11
α-helix	421-431	11
β-strand	439-440	2	10
α-helix	441-447	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RGECO1	A, B	protein	419	Gallus gallus, Discosoma sp., Rattus norvegicus	P0DP31 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4I2Y_1 RGECO1 (chains A, B)
MHHHHHHSSRRKWNKAGHAVRAIGRLSSPVVSERMYPEDGALKSEIKKGLRLKDGGHYAA
EVKTTYKAKKPVQLPGAYIVDIKLDIVSHNEDYTIVEQCERAEGRHSTGGMDELYKGGTG
GSLVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEAFQTAKLKVTKGGP
LPFAWDILSPQFMYGSKAYIKHPADIPDYFKLSFPEGFRWERVMNFEDGGIIHVNQDSSL
QDGVFIYKVKLRGTNFPPDGPVMQKKTMGWEATRDQLTEEQIAEFKEAFSLFDKDGDGTI
TTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTFDFPEFLTMMARKMNDTDSEEEIRE
AFRVFDKDGNGYIGAAELRHVMTDLGEKLTDEEVDEMIRVADIDGDGQVNYEEFVQMMTA
K

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	8

Primary citation

Genetically encoded calcium indicators for multi-color neural activity imaging and combination with optogenetics. Akerboom, J., Carreras Calderon, N., Tian, L. et al. Front Mol Neurosci (2013) 6:2-2. DOI 10.3389/fnmol.2013.00002 · PubMed

Other PDB entries of the same protein (UniProt P0DP31 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SG6 1.7 Å, Crystal Structure of Dimeric GCaMP2-LIA(linker 1)
3EVU 1.75 Å, Crystal structure of Calcium bound dimeric GCAMP2
3EK7 1.85 Å, Calcium-saturated GCaMP2 dimer
3SG5 1.9 Å, Crystal Structure of Dimeric GCaMP3-D380Y, QP(linker 1), LP(linker 2)
3SG7 1.9 Å, Crystal Structure of GCaMP3-KF(linker 1)
3EKH 2.0 Å, Calcium-saturated GCaMP2 T116V/K378W mutant monomer
3SG2 2.0 Å, Crystal Structure of GCaMP2-T116V,D381Y
3SG3 2.1 Å, Crystal Structure of GCaMP3-D380Y
3SG4 2.4 Å, Crystal Structure of GCaMP3-D380Y, LP(linker 2)
3WLC 2.49 Å, Crystal structure of dimeric GCaMP6m
3EK4 2.65 Å, Calcium-saturated GCaMP2 Monomer
3WLD 2.7 Å, Crystal structure of monomeric GCaMP6m

Browse structure collections

About this viewer

MolViewer shows 4I2Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.