Structure of Focal Adhesion Kinase catalytic domain in complex with an allosteric binding pyrazolobenzothiazine compound. Determined by X-ray diffraction at 1.75 Å resolution. Released 6 Feb 2013.
Explore 4I4F in 3D Show helices and sheets RCSB PDB PDBe
4I4F contains 18 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 416 | 1 | 1 |
| α-helix | 417-418 | 2 | |
| α-helix | 419-421 | 3 | |
| β-strand | 422-431 | 10 | 1 |
| β-strand | 434-441 | 8 | 1 |
| β-strand | 449-455 | 7 | 1 |
| α-helix | 462-474 | 13 | |
| β-strand | 483 | 1 | 2 |
| α-helix | 484-485 | 2 | |
| β-strand | 486-490 | 5 | 1 |
| α-helix | 495 | 1 | |
| β-strand | 496-500 | 5 | 1 |
| β-strand | 506 | 1 | 2 |
| α-helix | 507-513 | 7 | |
| α-helix | 520-539 | 20 | |
| α-helix | 547-549 | 3 | |
| β-strand | 551-556 | 6 | 2 |
| β-strand | 559-563 | 5 | 2 |
| β-strand | 565-567 | 3 | 1 |
| α-helix | 586-588 | 3 | |
| α-helix | 591-596 | 6 | |
| α-helix | 601-616 | 16 | |
| α-helix | 620-621 | 2 | |
| α-helix | 628-636 | 9 | |
| α-helix | 641-644 | 4 | |
| α-helix | 649-658 | 10 | |
| α-helix | 663-665 | 3 | |
| α-helix | 667-668 | 2 | |
| α-helix | 669-684 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Focal adhesion kinase 1 | A | protein | 281 | Homo sapiens | Q05397 (AlphaFold model) |
>4I4F_1 Focal adhesion kinase 1 (chains A) GAMGSSTRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVR EKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLIL YAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLP IKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPP NCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| 1BR | N-(4-tert-butylbenzyl)-1,5-dimethyl-1,5-dihydropyrazolo[4,3-c][2,1]benzothiazin… | C22 H26 N4 O2 S | 1 |
| IPA | Isopropyl alcohol | C3 H8 O | 1 |
Structure-based discovery of cellular-active allosteric inhibitors of FAK. Tomita, N., Hayashi, Y., Suzuki, S. et al. Bioorg Med Chem Lett (2013) 23:1779-1785. DOI 10.1016/j.bmcl.2013.01.047 · PubMed
Other PDB entries of the same protein (UniProt Q05397 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4I4F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.