4I6G: A vertebrate cryptochrome with FAD

a vertebrate cryptochrome with FAD. Determined by X-ray diffraction at 2.2 Å resolution. Released 13 Mar 2013.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Mus musculus
Chains: 2
Atoms: 8,109
Mol. weight: 118.95 kDa
Ligands: FAD
Released: 13 Mar 2013

Explore 4I6G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4I6G contains 65 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	1
α-helix	37-43	7
β-strand	48-55	8	1
α-helix	57-62	6
α-helix	67-85	19
β-strand	91-95	5	1
α-helix	98-108	11
β-strand	113-117	5	1
α-helix	122-136	15
β-strand	141-145	5	1
α-helix	153-159	7
α-helix	168-175	8
α-helix	179-189	11
α-helix	205-207	3
α-helix	210-212	3
α-helix	232-242	11
α-helix	260-262	3
α-helix	270-275	6
α-helix	280-294	15
α-helix	299-301	3
α-helix	302-305	4
α-helix	306-318	13
β-strand	339	1	2
α-helix	342-349	8
α-helix	356-368	13
α-helix	373-381	9
α-helix	382-386	5
β-strand	390	1	2
α-helix	392-402	11
α-helix	408-418	11
α-helix	435-440	6
α-helix	445-450	6
α-helix	452-454	3
α-helix	459-462	4
α-helix	465-467	3
α-helix	470-475	6
β-strand	480	1	3
β-strand	484	1	3
α-helix	485-487	3
α-helix	491-509	19

Chain B: 34 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	4
α-helix	37-43	7
β-strand	48-55	8	4
α-helix	57-62	6
α-helix	67-86	20
β-strand	91-95	5	4
α-helix	98-100	3
α-helix	102-109	8
β-strand	113-117	5	4
α-helix	122-131	10
β-strand	141-145	5	4
α-helix	153-159	7
α-helix	168-176	9
α-helix	179-189	11
α-helix	190-192	3
α-helix	194-196	3
α-helix	210-212	3
α-helix	232-242	11
α-helix	264-265	2
α-helix	270-275	6
α-helix	280-294	15
α-helix	299-301	3
α-helix	302-305	4
α-helix	306-318	13
α-helix	334-335	2
β-strand	339	1	5
α-helix	342-349	8
α-helix	356-368	13
α-helix	373-381	9
α-helix	382-386	5
β-strand	390	1	5
α-helix	392-402	11
α-helix	408-418	11
α-helix	435-440	6
α-helix	445-450	6
α-helix	452-454	3
α-helix	459-462	4
α-helix	465-467	3
α-helix	470-476	7
β-strand	480	1	6
β-strand	484	1	6
α-helix	485-487	3
α-helix	491-507	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cryptochrome-2	A, B	protein	512	Mus musculus	Q9R194 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4I6G_1 Cryptochrome-2 (chains A, B)
MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFA
ASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDS
EPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMEL
PKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLD
KHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTP
PLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDA
IMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSC
SAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCII
GVDYPRPIVNHAETSRLNIERMKQIYQQLSRY

Ligands and cofactors

ID	Name	Formula	Copies
FAD	Flavin-adenine dinucleotide	C27 H33 N9 O15 P2	2

Primary citation

SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket. Xing, W., Busino, L., Hinds, T.R. et al. Nature (2013) 496:64-68. DOI 10.1038/nature11964 · PubMed

Other PDB entries of the same protein (UniProt Q9R194 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7V8Y 1.9 Å, Crystal structure of mouse CRY2 in complex with SHP1703 compound
4MLP 1.94 Å, Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
7V8Z 1.95 Å, Crystal structure of mouse CRY2 in complex with SHP656 compound
6KX8 2.25 Å, Crystal structure of mouse Cryptochrome 2 in complex with TH301 compound
7EJ9 2.6 Å, Alternative crystal structure of mouse Cryptochrome 2 in complex with TH301 compound
4I6E 2.7 Å, A vertebrate cryptochrome
4I6J 2.7 Å, A ubiquitin ligase-substrate complex
4U8H 2.8 Å, Crystal Structure of Mammalian Period-Cryptochrome Complex
7D0N 2.8 Å, Crystal structure of mouse CRY2 apo form

Browse structure collections

About this viewer

MolViewer shows 4I6G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.