Structure of the Spt16 Middle Domain Reveals Functional Features of the Histone Chaperone FACT. Determined by X-ray diffraction at 1.95 Å resolution. Released 20 Feb 2013.
Explore 4IOY in 3D Show helices and sheets RCSB PDB PDBe
4IOY contains 10 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 679-683 | 5 | 1 |
| β-strand | 684-686 | 3 | 2 |
| β-strand | 696-700 | 5 | 1 |
| β-strand | 704-707 | 4 | 1 |
| α-helix | 712-714 | 3 | |
| β-strand | 717-720 | 4 | 1 |
| α-helix | 721-723 | 3 | |
| β-strand | 724-730 | 7 | 2 |
| β-strand | 737-750 | 14 | 2 |
| β-strand | 753-763 | 11 | 2 |
| α-helix | 790-818 | 29 | |
| β-strand | 825-827 | 3 | 2 |
| α-helix | 830-832 | 3 | |
| β-strand | 834-836 | 3 | 3 |
| β-strand | 837 | 1 | 4 |
| β-strand | 843-845 | 3 | 3 |
| β-strand | 846-847 | 2 | 5 |
| β-strand | 851-854 | 4 | 5 |
| α-helix | 860 | 1 | |
| β-strand | 861-864 | 4 | 5 |
| α-helix | 865-867 | 3 | |
| β-strand | 868-874 | 7 | 6 |
| β-strand | 882-889 | 8 | 6 |
| α-helix | 895-896 | 2 | |
| β-strand | 897-903 | 7 | 6 |
| α-helix | 904-906 | 3 | |
| α-helix | 907-916 | 10 | |
| β-strand | 921-923 | 3 | 6 |
| α-helix | 931-939 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FACT complex subunit SPT16 | X | protein | 285 | Saccharomyces cerevisiae | P32558 (AlphaFold model) |
>4IOY_1 FACT complex subunit SPT16 (chains X) GIDPFTHMGRTKRLDQIFVRPNPDTKRVPSTVFIHENGIRFQSPLRTDSRIDILFSNIKN LIFQSCKGELIVVIHIHLKNPILMGKKKIQDVQFYREASDMSVDETGRFRRYGDEDELEQ EQEERRKRAALDKEFKYFADAIAEASNGLLTVENTFRDLGFQGVPNRSAVFCMPTTDCLV QLIEPPFLVINLEEVEICILERVQFGLKNFDMVFVYKDFNKPVTHINTVPIESLDFLKQW LTDMDIPYTVSTINLNWATIMKSLQDDPYQFFLDGGWNFLATGSD
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
Structure of the Spt16 Middle Domain Reveals Functional Features of the Histone Chaperone FACT. Kemble, D.J., Whitby, F.G., Robinson, H. et al. J Biol Chem (2013) 288:10188-10194. DOI 10.1074/jbc.C113.451369 · PubMed
Other PDB entries of the same protein (UniProt P32558 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4IOY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.