Auto-inhibited ERG Ets domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 31 Jul 2013.
Explore 4IRH in 3D Show helices and sheets RCSB PDB PDBe
4IRH contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 296-305 | 10 | |
| α-helix | 307-309 | 3 | |
| β-strand | 314-315 | 2 | 1 |
| β-strand | 321-323 | 3 | 1 |
| α-helix | 327-338 | 12 | |
| α-helix | 345-353 | 9 | |
| α-helix | 354-357 | 4 | |
| β-strand | 361-363 | 3 | 1 |
| α-helix | 364 | 1 | |
| β-strand | 370-373 | 4 | 1 |
| α-helix | 375-381 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcriptional regulator ERG | A | protein | 129 | Homo sapiens | P11308 (AlphaFold model) |
>4IRH_1 Transcriptional regulator ERG (chains A) GAMVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTN GEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIA QALQPHPPE
Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited. Regan, M.C., Horanyi, P.S., Pryor, E.E. et al. Proc Natl Acad Sci U S A (2013) 110:13374-13379. DOI 10.1073/pnas.1301726110 · PubMed
Other PDB entries of the same protein (UniProt P11308 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4IRH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.