5YBC: Native ETS-domain domain of Ergp55

X-ray structure of native ETS-domain domain of Ergp55. Determined by X-ray diffraction at 2.5 Å resolution. Released 19 Sept 2018.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,539
Mol. weight: 21.98 kDa
Released: 19 Sept 2018

Explore 5YBC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YBC contains 12 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	313-322	10
α-helix	324-328	5
β-strand	330-333	4	2
β-strand	338-341	4	2
α-helix	344-354	11
α-helix	362-371	10
α-helix	372-374	3
β-strand	378-380	3	2
β-strand	387-390	4	2
α-helix	392-398	7

Chain C: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	313-322	10
α-helix	324-328	5
β-strand	331-333	3	1
β-strand	338-340	3	1
α-helix	344-354	11
α-helix	362-370	9
α-helix	371-374	4
β-strand	378-380	3	1
β-strand	387-390	4	1
α-helix	392-399	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional regulator ERG	A, C	protein	92	Homo sapiens	P11308 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5YBC_1 Transcriptional regulator ERG (chains A, C)
QIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRAL
RYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP

Primary citation

Comparative structure analysis of the ETSi domain of ERG3 and its complex with the E74 promoter DNA sequence. Sharma, R., Gangwar, S.P., Saxena, A.K. Acta Crystallogr F Struct Biol Commun (2018) 74:656-663. DOI 10.1107/S2053230X1801110X · PubMed

Other PDB entries of the same protein (UniProt P11308 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IRG 1.7 Å, Uninhibited DNA-binding domain of the Ets transcription factor ERG
4IRH 2.1 Å, Auto-inhibited ERG Ets domain
5YBD 2.77 Å, X-ray structure of ETS domain of Ergp55 in complex with E74DNA
4IRI 2.77 Å, Auto-inhibited ERG Ets Domain-DNA Complex
6VGE 4.25 Å, Crystal structure of the DNA binding domains of human transcription factor ERG, human…
6VGG 4.31 Å, Crystal structure of the DNA binding domains of human transcription factor ERG, human…
1SXE The solution structure of the Pointed (PNT) domain from the transcrition factor Erg

Browse structure collections

About this viewer

MolViewer shows 5YBC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.