4IRI: Auto-inhibited ERG Ets Domain-DNA Complex

Auto-inhibited ERG Ets Domain-DNA Complex. Determined by X-ray diffraction at 2.77 Å resolution. Released 31 Jul 2013.

Method: X-ray diffraction
Resolution: 2.77 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,272
Mol. weight: 22.2 kDa
Released: 31 Jul 2013

Explore 4IRI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4IRI contains 6 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	296-304	9
α-helix	307-311	5
β-strand	313-315	3	1
β-strand	321-324	4	1
α-helix	327-337	11
α-helix	345-353	9
α-helix	355-358	4
β-strand	361-363	3	1
β-strand	370-373	4	1
α-helix	375-381	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional regulator ERG	A	protein	129	Homo sapiens	P11308 (AlphaFold model)
DNA (5'-d(gpapcpcpgpgpapapgptpgpg)-3')	B	DNA	12
DNA (5'-d(cpcpapcptptpcpcpgpgptpc)-3')	C	DNA	12

Sequence of entity 1 (A), FASTA

>4IRI_1 Transcriptional regulator ERG (chains A)
GAMVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTN
GEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIA
QALQPHPPE

Sequence of entity 2 (B), FASTA

>4IRI_2 DNA (5'-D(*GP*AP*CP*CP*GP*GP*AP*AP*GP*TP*GP*G)-3') (chains B)
GACCGGAAGTGG

Sequence of entity 3 (C), FASTA

>4IRI_3 DNA (5'-D(*CP*CP*AP*CP*TP*TP*CP*CP*GP*GP*TP*C)-3') (chains C)
CCACTTCCGGTC

Primary citation

Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited. Regan, M.C., Horanyi, P.S., Pryor, E.E. et al. Proc Natl Acad Sci U S A (2013) 110:13374-13379. DOI 10.1073/pnas.1301726110 · PubMed

Other PDB entries of the same protein (UniProt P11308 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IRG 1.7 Å, Uninhibited DNA-binding domain of the Ets transcription factor ERG
4IRH 2.1 Å, Auto-inhibited ERG Ets domain
5YBC 2.5 Å, X-ray structure of native ETS-domain domain of Ergp55
5YBD 2.77 Å, X-ray structure of ETS domain of Ergp55 in complex with E74DNA
6VGE 4.25 Å, Crystal structure of the DNA binding domains of human transcription factor ERG, human…
6VGG 4.31 Å, Crystal structure of the DNA binding domains of human transcription factor ERG, human…
1SXE The solution structure of the Pointed (PNT) domain from the transcrition factor Erg

Browse structure collections

About this viewer

MolViewer shows 4IRI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.