4IUF: Human TDP-43 RRM1 Domain

Crystal Structure of Human TDP-43 RRM1 Domain in Complex with a Single-stranded DNA. Determined by X-ray diffraction at 2.75 Å resolution. Released 29 Jan 2014.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 830
Mol. weight: 11.87 kDa
Released: 29 Jan 2014

Explore 4IUF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4IUF contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	106-109	4	1
α-helix	117-125	9
β-strand	130-137	8	1
β-strand	144-152	9	1
α-helix	155-162	8
β-strand	166-168	3	2
β-strand	171-173	3	2
β-strand	174-176	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TAR DNA-binding protein 43	A	protein	77	Homo sapiens	Q13148 (AlphaFold model)
5'-d(gptptpgp(xua)pgpcpgp*t)-3'	B	DNA	9

Sequence of entity 1 (A), FASTA

>4IUF_1 TAR DNA-binding protein 43 (chains A)
TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVM
SQRHMIDGRWCDCKLPN

Sequence of entity 2 (B), FASTA

>4IUF_2 5'-D(*GP*TP*TP*GP*(XUA)P*GP*CP*GP*T)-3' (chains B)
GTTGAGCGT

Primary citation

The crystal structure of TDP-43 RRM1-DNA complex reveals the specific recognition for UG- and TG-rich nucleic acids. Kuo, P.H., Chiang, C.H., Wang, Y.T. et al. Nucleic Acids Res (2014) 42:4712-4722. DOI 10.1093/nar/gkt1407 · PubMed

Other PDB entries of the same protein (UniProt Q13148 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6CF4 0.75 Å, Segment NFGTFS, with familial mutation A315T and phosphorylated threonine, from the low…
5WHP 1.0 Å, Crystal structure of the segment, NFGTFS, from the A315T familial variant of the low…
5WKB 1.0 Å, MicroED structure of the segment, NFGEFS, from the A315E familial variant of the low…
5WIA 1.0 Å, Crystal structure of the segment, GNNSYS, from the low complexity domain of TDP-43,…
5WHN 1.1 Å, Crystal structure of the segment, NFGAFS, from the low complexity domain of TDP-43,…
5WIQ 1.25 Å, Crystal structure of the segment, GFNGGFG, from the low complexity domain of TDP-43,…
5W50 1.4 Å, Crystal structure of the segment, LIIKGI, from the RRM2 of TDP-43, residues 248-253
5W52 1.4 Å, MicroED structure of the segment, DLIIKGISVHI, from the RRM2 of TDP-43, residues 247-257
6CFH 1.5 Å, SWGMMGMLASQ segment from the low complexity domain of TDP-43
5WKD 1.8 Å, Crystal structure of the segment, GNNQGSN, from the low complexity domain of TDP-43,…
5MDI 2.1 Å, Crystal structure of TDP-43 N-terminal domain at 2.1 A resolution
7N9H 2.2 Å, Structure of the mammalian importin a1 bound to the TDP-43 NLS

Browse structure collections

About this viewer

MolViewer shows 4IUF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.