Crystal structure of AdTx1 (rho-Da1a) from eastern green mamba (Dendroaspis angusticeps). Determined by X-ray diffraction at 1.95 Å resolution. Released 8 May 2013.
Explore 4IYE in 3D Show helices and sheets RCSB PDB PDBe
4IYE contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| β-strand | 11-16 | 6 | 1 |
| α-helix | 17-18 | 2 | |
| β-strand | 23-32 | 10 | 2 |
| β-strand | 35-43 | 9 | 2 |
| α-helix | 46-49 | 4 | |
| β-strand | 54-58 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Toxin AdTx1 | A | protein | 66 | Dendroaspis angusticeps | P85092 (AlphaFold model) |
>4IYE_1 Toxin AdTx1 (chains A) GLTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPAIYDSTRGCAATCPIPENYDSIHCCK TDKCNE
Crystallization of recombinant green mamba rho-Da1a toxin during a lyophilization procedure and its structure determination. Maiga, A., Vera, L., Marchetti, C. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2013) 69:704-709. DOI 10.1107/S1744309113011470 · PubMed
Other PDB entries of the same protein (UniProt P85092 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4IYE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.