Putative Ancestral Mamba toxin 1 (AncTx1-W28R/I38S). Determined by X-ray diffraction at 1.8 Å resolution. Released 3 May 2017.
Explore 5MG9 in 3D Show helices and sheets RCSB PDB PDBe
5MG9 contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 1 |
| β-strand | 12-16 | 5 | 1 |
| α-helix | 17-18 | 2 | |
| β-strand | 23-32 | 10 | 2 |
| β-strand | 35-43 | 9 | 2 |
| α-helix | 46-48 | 3 | |
| β-strand | 53-58 | 6 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| AncTx1-W28R/I38S | A | protein | 65 | Dendroaspis angusticeps | P85092 (AlphaFold model) |
>5MG9_1 AncTx1-W28R/I38S (chains A) LTCVKSKSIFGVTTEDCPDGQNLCFKRRHYIVPKMYDSTRGCAATCPIAENRDVIHCCGT DKCNE
Water and common crystallization additives (SO4, EDO) are not listed.
Ancestral protein resurrection and engineering opportunities of the mamba aminergic toxins. Blanchet, G., Alili, D., Protte, A. et al. Sci Rep (2017) 7:2701-2701. DOI 10.1038/s41598-017-02953-0 · PubMed
Other PDB entries of the same protein (UniProt P85092 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5MG9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.