4JEU: Syntaxin-binding protein 1

Crystal Structure of Munc18a and Syntaxin1 with native N-terminus complex. Determined by X-ray diffraction at 3.2 Å resolution. Released 17 Jul 2013.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 6,303
Mol. weight: 95.39 kDa
Released: 17 Jul 2013

Explore 4JEU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JEU contains 38 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	6-13	8
α-helix	14-20	7
β-strand	29-33	5	1
α-helix	35-42	8
α-helix	47-51	5
β-strand	55-60	6	1
α-helix	65-67	3
β-strand	68	1	2
β-strand	72-77	6	1
α-helix	81-88	8
β-strand	99	1	2
β-strand	102-106	5	1
α-helix	109-111	3
α-helix	112-120	9
α-helix	122-125	4
β-strand	127-132	6	1
β-strand	138-139	2	3
β-strand	144-146	3	3
α-helix	152-157	6
α-helix	165-182	18
β-strand	188-191	4	3
α-helix	196-213	18
β-strand	229-233	5	3
α-helix	235-237	3
α-helix	240-243	4
β-strand	248	1	4
α-helix	249-256	8
β-strand	263-269	7	5
β-strand	274-280	7	5
α-helix	286-291	6
β-strand	295	1	4
α-helix	296-312	17
α-helix	335-337	3
α-helix	338-358	21
α-helix	361-374	14
β-strand	376	1	6
β-strand	382	1	6
α-helix	387-395	9
α-helix	401-414	14
β-strand	418	1	7
α-helix	420-430	11
α-helix	434-442	9
α-helix	443-446	4
β-strand	451	1	7
α-helix	463-465	3
α-helix	474-476	3
α-helix	481-491	11
β-strand	536-541	6	3
β-strand	545-546	2	8
α-helix	547-560	14
β-strand	564-569	6	3
β-strand	572-573	2	8
α-helix	575-583	9

Chain B: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	31-61	31
α-helix	69-104	36
α-helix	111-156	46
α-helix	162-170	9
α-helix	186-211	26
α-helix	213-225	13
α-helix	229-231	3
α-helix	233-238	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Syntaxin-binding protein 1	A	protein	590	Rattus norvegicus	P61765 (AlphaFold model)
Syntaxin-1A	B	protein	242	Rattus norvegicus	P32851 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JEU_1 Syntaxin-binding protein 1 (chains A)
PIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDIN
KRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSR
AAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCAT
LKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSP
VLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVSQE
VTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQGTV
DKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITEEN
LNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPII
KDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFIL
GGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEI

Sequence of entity 2 (B), FASTA

>4JEU_2 Syntaxin-1A (chains B)
KDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAI
LASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHS
TLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGI
IMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAV
DY

Primary citation

Syntaxin1a variants lacking an N-peptide or bearing the LE mutation bind to Munc18a in a closed conformation. Colbert, K.N., Hattendorf, D.A., Weiss, T.M. et al. Proc Natl Acad Sci U S A (2013) 110:12637-12642. DOI 10.1073/pnas.1303753110 · PubMed

Other PDB entries of the same protein (UniProt P61765 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JEH 2.5 Å, Crystal Structure of Munc18a and Syntaxin1 lacking N-peptide complex
3C98 2.6 Å, Revised structure of the munc18a-syntaxin1 complex
7XSJ 3.2 Å, The structure of the Mint1/Munc18-1/syntaxin-1 complex
3PUJ 3.31 Å, Crystal structure of the MUNC18-1 and SYNTAXIN4 N-Peptide complex
6LPC 3.4 Å, Crystal Structure of rat Munc18-1 with K332E/K333E mutation
7UDB 3.5 Å, Cryo-EM structure of a synaptobrevin-Munc18-1-syntaxin-1 complex class 2
7UDC 3.7 Å, cryo-EM structures of a synaptobrevin-Munc18-1-syntaxin-1 complex class1

Browse structure collections

About this viewer

MolViewer shows 4JEU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.