6LPC: Rat Munc18-1 with K332E/K333E mutation

Crystal Structure of rat Munc18-1 with K332E/K333E mutation. Determined by X-ray diffraction at 3.4 Å resolution. Released 15 Jul 2020.

Method: X-ray diffraction
Resolution: 3.4 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 7,114
Mol. weight: 135.33 kDa
Released: 15 Jul 2020

Explore 6LPC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LPC contains 53 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
α-helix	15-19	5
α-helix	20-22	3
β-strand	29-32	4	1
α-helix	35-44	10
α-helix	47-49	3
β-strand	55-59	5	1
β-strand	73-75	3	1
β-strand	76	1	2
α-helix	81-90	10
β-strand	102-104	3	3
β-strand	105	1	2
α-helix	112-119	8
α-helix	122-125	4
β-strand	127-130	4	3
β-strand	138-141	4	4
β-strand	144-146	3	4
α-helix	151-157	7
α-helix	162-164	3
α-helix	165-182	18
β-strand	188-191	4	4
α-helix	196-213	18
α-helix	224-226	3
β-strand	229-234	6	4
α-helix	235-237	3
β-strand	248	1	5
α-helix	249-256	8
β-strand	260	1	6
β-strand	263-265	3	6
β-strand	278-280	3	6
α-helix	286-291	6
β-strand	295	1	5
α-helix	299-310	12
α-helix	328-358	31
α-helix	362-373	12
β-strand	376	1	7
β-strand	382	1	7
α-helix	383	1
α-helix	387-395	9
α-helix	401-415	15
β-strand	418	1	8
α-helix	421-428	8
α-helix	434-437	4
α-helix	441-446	6
β-strand	451	1	8
β-strand	473	1	9
β-strand	476	1	9
α-helix	481-487	7
β-strand	501	1	4
β-strand	536-542	7	4
β-strand	545-546	2	10
α-helix	547-560	14
β-strand	564-565	2	4
β-strand	567-569	3	4
β-strand	572-573	2	10
α-helix	575-582	8

Chain B: 25 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
α-helix	15-19	5
α-helix	20-22	3
β-strand	29-32	4	11
α-helix	35-44	10
α-helix	47-50	4
β-strand	55-59	5	11
β-strand	75	1	12
β-strand	104	1	12
β-strand	138-141	4	13
β-strand	144-146	3	13
α-helix	153-157	5
α-helix	162-164	3
α-helix	165-182	18
β-strand	188-191	4	14
α-helix	196-213	18
α-helix	224-227	4
β-strand	229-234	6	14
α-helix	235-237	3
β-strand	248	1	15
α-helix	249-256	8
β-strand	260	1	16
β-strand	263-266	4	16
β-strand	277-280	4	16
α-helix	286-291	6
β-strand	295	1	15
α-helix	299-310	12
α-helix	329-358	30
α-helix	362-373	12
α-helix	378-380	3
α-helix	387-395	9
α-helix	401-415	15
α-helix	420-428	9
α-helix	434-441	8
α-helix	444-446	3
β-strand	473	1	17
β-strand	476	1	17
α-helix	481-487	7
β-strand	536-542	7	14
β-strand	545-546	2	18
α-helix	547-560	14
β-strand	564-565	2	14
β-strand	567-569	3	13
β-strand	572-573	2	18
α-helix	575-582	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Syntaxin-binding protein 1	A, B	protein	594	Rattus norvegicus	P61765 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6LPC_1 Syntaxin-binding protein 1 (chains A, B)
MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVED
INKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVK
SRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLC
ATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPS
SPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVS
QEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLEEMPQYQKELSKYSTHLHLAEDCMKHYQG
TVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITE
ENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTP
IIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIF
ILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS

Primary citation

Munc13 activates the Munc18-1/syntaxin-1 complex and enables Munc18-1 to prime SNARE assembly. Wang, X., Gong, J., Zhu, L. et al. EMBO J (2020) 39:e103631-e103631. DOI 10.15252/embj.2019103631 · PubMed

Other PDB entries of the same protein (UniProt P61765 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JEH 2.5 Å, Crystal Structure of Munc18a and Syntaxin1 lacking N-peptide complex
3C98 2.6 Å, Revised structure of the munc18a-syntaxin1 complex
4JEU 3.2 Å, Crystal Structure of Munc18a and Syntaxin1 with native N-terminus complex
7XSJ 3.2 Å, The structure of the Mint1/Munc18-1/syntaxin-1 complex
3PUJ 3.31 Å, Crystal structure of the MUNC18-1 and SYNTAXIN4 N-Peptide complex
7UDB 3.5 Å, Cryo-EM structure of a synaptobrevin-Munc18-1-syntaxin-1 complex class 2
7UDC 3.7 Å, cryo-EM structures of a synaptobrevin-Munc18-1-syntaxin-1 complex class1

Browse structure collections

About this viewer

MolViewer shows 6LPC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.