4JKW: Extracellular domain of butyrophilin BTN3A1

Structure of the extracellular domain of butyrophilin BTN3A1 in complex with Isopentenyl pyrophosphate (IPP). Determined by X-ray diffraction at 2.01 Å resolution. Released 24 Jul 2013.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,065
Mol. weight: 14.02 kDa
Ligands: IPE
Released: 24 Jul 2013

Explore 4JKW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JKW contains 3 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	13-16	4	2
β-strand	21-28	8	1
β-strand	37-42	6	2
β-strand	48-53	6	2
β-strand	56-57	2	2
α-helix	59-61	3
β-strand	70-73	4	1
α-helix	77-79	3
β-strand	81-86	6	1
α-helix	91-93	3
β-strand	95-103	9	2
β-strand	106-117	12	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Butyrophilin subfamily 3 member A1	A	protein	124	Homo sapiens	O00481 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JKW_1 Butyrophilin subfamily 3 member A1 (chains A)
SAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVED
RQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVLEHH
HHHH

Ligands and cofactors

ID	Name	Formula	Copies
IPE	3-methylbut-3-enyl trihydrogen diphosphate	C5 H12 O7 P2	1

Primary citation

Butyrophilin 3A1 binds phosphorylated antigens and stimulates human gamma delta T cells. Vavassori, S., Kumar, A., Wan, G.S. et al. Nat Immunol (2013) 14:908-916. DOI 10.1038/ni.2665 · PubMed

Other PDB entries of the same protein (UniProt O00481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ITA 1.2 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 mutant
6ISM 1.25 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 mutant
8IZE 1.4 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with 4-HMBPP
4N7I 1.4 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1
4N7U 1.46 Å, Crystal Structure of Intracellular B30.2 Domain of BTN3A1 in Complex with CHDMAPP
5LYG 1.6 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 bound to malonate
8IZG 1.6 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 in complex with 5-HMBPP
5LYK 1.7 Å, Crystal structure of intracellular B30.2 domain of BTN3A1 bound to citrate
8IXV 1.72 Å, Crystal structure of intracellular B30.2 domain of BTN3A in complex with 2Cl-HMBPP
4K55 1.91 Å, Structure of the extracellular domain of butyrophilin BTN3A1 in complex with…
5HM7 1.93 Å, The Intracellular domain of Butyrophilin 3A1 protein
4F80 1.94 Å, Crystal Structure of the human BTN3A1 ectodomain

Browse structure collections

About this viewer

MolViewer shows 4JKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.