4JLU: BRCA1 BRCT with doubly phosphorylated Abraxas

Crystal structure of BRCA1 BRCT with doubly phosphorylated Abraxas. Determined by X-ray diffraction at 3.5 Å resolution. Released 10 Sept 2014.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,792
Mol. weight: 25.6 kDa
Released: 10 Sept 2014

Explore 4JLU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JLU contains 8 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	1652-1654	3	1
α-helix	1659-1671	13
β-strand	1686-1688	3	1
β-strand	1689	1	2
β-strand	1697	1	3
α-helix	1701-1704	4
β-strand	1712	1	1
β-strand	1714	1	4
β-strand	1715	1	2
α-helix	1716-1718	3
α-helix	1720-1723	4
β-strand	1735	1	4
β-strand	1739	1	3
β-strand	1743	1	3
α-helix	1748-1754	7
β-strand	1764-1768	5	5
α-helix	1777-1787	11
β-strand	1791	1	5
α-helix	1795-1797	3
β-strand	1805-1810	6	5
β-strand	1832-1834	3	5
α-helix	1835-1843	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Breast cancer type 1 susceptibility protein	A	protein	211	Homo sapiens	P38398 (AlphaFold model)
BRCA1-A complex subunit Abraxas	B	protein	11	Homo sapiens	Q6UWZ7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JLU_1 Breast cancer type 1 susceptibility protein (chains A)
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIA
GGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICC
YGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMC
EAPVVTREWVLDSVALYQCQELDTYLIPQIP

Sequence of entity 2 (B), FASTA

>4JLU_2 BRCA1-A complex subunit Abraxas (chains B)
GFGEYSRSPTF

Primary citation

Crystal structure of BRCA1 BRCT with doubly phosphorylated Abraxas. Badgujar, D., Varma, A.K. To be published.

Other PDB entries of the same protein (UniProt P38398 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RS8 1.31 Å, Crystal structure of BRCA1 BRCTs in complex with a RIF1 phosphopeptide
4IGK 1.75 Å, Structure of human BRCA1 BRCT in complex with ATRIP peptide
1T15 1.85 Å, Crystal Structure of the Brca1 BRCT Domains in Complex with the Phosphorylated…
4IFI 2.2 Å, Structure of human BRCA1 BRCT in complex with BAAT peptide
1T29 2.3 Å, Crystal structure of the BRCA1 BRCT repeats bound to a phosphorylated BACH1 peptide
1JNX 2.5 Å, Crystal structure of the BRCT repeat region from the breast cancer associated protein,…
1Y98 2.5 Å, Structure of the BRCT repeats of BRCA1 bound to a CtIP phosphopeptide.
3PXB 2.5 Å, Impact of BRCA1 BRCT domain missense substitutions on phospho-peptide recognition: T1700A
4Y2G 2.5 Å, Structure of BRCA1 BRCT domains in complex with Abraxas single phosphorylated peptide
3PXA 2.55 Å, Impact of BRCA1 BRCT domain missense substitutions on phospho-peptide recognition: G1656D
3K0H 2.7 Å, The crystal structure of BRCA1 BRCT in complex with a minimal recognition tetrapeptide…
3K0K 2.7 Å, Crystal Structure of BRCA1 BRCT in complex with a minimal recognition tetrapeptide with…

Browse structure collections

About this viewer

MolViewer shows 4JLU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.