4JVU: IgM C2-domain from mouse

IgM C2-domain from mouse. Determined by X-ray diffraction at 1.3 Å resolution. Released 12 Jun 2013.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,906
Mol. weight: 25.54 kDa
Released: 12 Jun 2013

Explore 4JVU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JVU contains 8 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	231	1	1
α-helix	232-233	2
β-strand	234-238	5	2
β-strand	239	1	3
β-strand	246	1	2
α-helix	251	1
β-strand	252-262	11	2
β-strand	263	1	1
β-strand	268-273	6	4
β-strand	276-277	2	4
α-helix	278	1
β-strand	282-284	3	2
α-helix	285-287	3
β-strand	288-289	2	2
β-strand	299-308	10	2
α-helix	309-313	5
β-strand	318-324	7	4
β-strand	327-333	7	4

Chain B: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	231	1	5
α-helix	232-233	2
β-strand	234-238	5	6
β-strand	239	1	3
β-strand	253-262	10	6
β-strand	263	1	5
β-strand	268-273	6	7
β-strand	276-277	2	7
β-strand	282-284	3	6
α-helix	285-287	3
β-strand	288-289	2	6
β-strand	299-307	9	6
α-helix	309-313	5
β-strand	318-324	7	7
β-strand	327-333	7	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig mu chain C region membrane-bound form	A, B	protein	117	Mus musculus	P01872 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4JVU_1 Ig mu chain C region membrane-bound form (chains A, B)
MGIPAVAEMNPNVNVFVPPRDGFSGPAPRKSKLICEATNFTPKPITVSWLKDGKLVESGF
TTDPVTIENKGSTPQTYKVISTLTISEIDWLNLNVYTCRVDHRGLTFLKNVSSTCAA

Primary citation

High-resolution structures of the IgM Fc domains reveal principles of its hexamer formation. Muller, R., Grawert, M.A., Kern, T. et al. Proc Natl Acad Sci U S A (2013) 110:10183-10188. DOI 10.1073/pnas.1300547110 · PubMed

Other PDB entries of the same protein (UniProt P01872 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JVW 2.0 Å, IgM C4-domain from mouse
8E4C 4.0 Å, IgM BCR fab truncated form
8EMA 8.2 Å, mouse full length B cell receptor
4BA8 High resolution NMR structure of the C mu3 domain from IgM

Browse structure collections

About this viewer

MolViewer shows 4JVU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.