4JZN: Anti-HCV E2 Fab HC84-1 heavy chain

Three dimensional structure of broadly neutralizing human anti - Hepatitis C virus (HCV) glycoprotein E2 Fab fragment HC84-1. Determined by X-ray diffraction at 2.05 Å resolution. Released 5 Jun 2013.

Method: X-ray diffraction
Resolution: 2.05 Å
Organisms: Homo sapiens, Hepatitis C virus (isolate H)
Chains: 7
Atoms: 10,222
Mol. weight: 153.87 kDa
Released: 5 Jun 2013

Explore 4JZN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JZN contains 47 α-helices and 139 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
α-helix	7-9	3
β-strand	10-12	3	2
β-strand	18-24	7	1
β-strand	33-39	7	2
β-strand	45-52	8	2
β-strand	57-60	4	2
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-99	8	2
β-strand	108-109	2	2
β-strand	113-117	5	2
α-helix	121-122	2
β-strand	123	1	3
β-strand	126-130	5	4
β-strand	141-151	11	4
β-strand	152	1	3
β-strand	157-160	4	5
α-helix	161-163	3
β-strand	165	1	5
β-strand	169-171	3	4
α-helix	172-174	3
β-strand	175-176	2	4
β-strand	182-191	10	4
α-helix	192-194	3
β-strand	195	1	6
β-strand	198	1	6
β-strand	201-206	6	5
α-helix	207-209	3
β-strand	211-216	6	5

Chains B, D and P: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	7
β-strand	9-12	4	8
β-strand	18-23	6	7
α-helix	27-29	3
β-strand	33-37	5	8
β-strand	44-47	4	8
β-strand	48	1	9
β-strand	52	1	9
β-strand	61-66	6	7
β-strand	69-74	6	7
α-helix	79-81	3
β-strand	83-91	9	8
β-strand	94-97	4	8
β-strand	101-105	5	8
β-strand	110	1	10
α-helix	111-112	2
β-strand	113-117	5	11
α-helix	118-120	3
α-helix	121-124	4
β-strand	128-138	11	11
β-strand	139	1	10
β-strand	144-149	6	12
β-strand	152-153	2	12
α-helix	154	1
β-strand	158-162	5	11
α-helix	163-166	4
β-strand	172-181	10	11
α-helix	182-186	5
β-strand	190-196	7	12
β-strand	204-209	6	12

Chain C: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	13
α-helix	7-9	3
β-strand	10-12	3	14
β-strand	18-21	4	15
β-strand	22	1	13
β-strand	33-39	7	14
β-strand	46-52	7	14
β-strand	57-60	4	14
β-strand	68-70	3	15
β-strand	80-83	4	15
α-helix	88-90	3
β-strand	92-99	8	14
β-strand	108-109	2	14
β-strand	113-117	5	14
α-helix	121-122	2
β-strand	123	1	16
β-strand	126-130	5	17
α-helix	131-133	3
β-strand	141-151	11	17
β-strand	152	1	16
β-strand	157-160	4	18
α-helix	161-163	3
β-strand	165	1	18
β-strand	169-171	3	17
α-helix	172-174	3
β-strand	175-176	2	17
β-strand	182-191	10	17
α-helix	192-194	3
β-strand	195	1	19
β-strand	198	1	19
β-strand	200-206	7	18
α-helix	207-209	3
β-strand	211-217	7	18
α-helix	219-221	3

Chain I: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	26
α-helix	7-9	3
β-strand	10-12	3	27
β-strand	18-25	8	26
β-strand	32-39	8	27
β-strand	46-52	7	27
β-strand	57-60	4	27
β-strand	68-72	5	26
β-strand	78-83	6	26
α-helix	88-90	3
β-strand	92-100	9	27
β-strand	108-109	2	27
β-strand	113-117	5	27
α-helix	121-122	2
β-strand	123	1	28
β-strand	126-130	5	29
β-strand	141-151	11	29
β-strand	152	1	28
β-strand	157-160	4	30
α-helix	161-163	3
β-strand	165	1	30
β-strand	169-171	3	29
α-helix	172-174	3
β-strand	175-176	2	29
β-strand	182-191	10	29
α-helix	192-194	3
β-strand	195	1	31
β-strand	198	1	31
β-strand	201-206	6	30
α-helix	207-209	3
β-strand	211-216	6	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Anti-HCV E2 Fab HC84-1 heavy chain	A, C, I	protein	261	Homo sapiens
Anti-HCV E2 Fab HC84-1 light chain	B, D, P	protein	215	Homo sapiens
Envelope glycoprotein E2	K	protein	13	Hepatitis C virus (isolate H)	P27958 (AlphaFold model)

Sequence of entity 1 (A, C, I), FASTA

>4JZN_1 Anti-HCV E2 Fab HC84-1 heavy chain (chains A, C, I)
QVQLVQSGAEVKKPGSSVKVSCEASGGTLSNYVITWVRQAPGQGLEWMGGFIPTFRTAMY
AQGFQGRVTITADESTSIAYMELTNLRSEDTAVYYCARGPLSRGYYDYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKLEDDDDKAGWSHPQFE
KGGGSGGGSGGGSWSHPQFEK

Sequence of entity 2 (B, D, P), FASTA

>4JZN_2 Anti-HCV E2 Fab HC84-1 light chain (chains B, D, P)
RSSYVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIP
ERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSVVFGGGTKLTVLRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (K), FASTA

>4JZN_3 Envelope glycoprotein E2 (chains K)
NTGWLAGLFYQHK

Primary citation

Structural basis of HCV neutralization by human monoclonal antibodies resistant to viral neutralization escape. Krey, T., Meola, A., Keck, Z.Y. et al. PLoS Pathog (2013) 9:e1003364-e1003364. DOI 10.1371/journal.ppat.1003364 · PubMed

Other PDB entries of the same protein (UniProt P27958 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BZY 1.6 Å, Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423…
5FGB 1.65 Å, Three dimensional structure of broadly neutralizing human anti - Hepatitis C virus (HCV)…
6BQJ 1.69 Å, Crystal structure of hepatis C virus protease (NS3) complexed with tripeptidic acyl…
2XI3 1.7 Å, HCV-H77 NS5B Polymerase Complexed With GTP
4N0Y 1.75 Å, Structure of the Hepatitis C Envelope Glycoprotein E1 antigenic region 314-324 bound to…
2XI2 1.8 Å, HCV-H77 NS5B Apo Polymerase
6UYD 1.9 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2mc3-v1 redesigned core from…
5FGC 1.9 Å, Three dimensional structure of broadly neutralizing human anti - Hepatitis C virus (HCV)…
6BQK 1.97 Å, Crystal structure of hepatis C virus protease (NS3) complexed with tripeptidic acyl…
5EOC 1.98 Å, Crystal structure of Fab C2 in complex with a Cyclic variant of Hepatitis C Virus E2…
2O8M 2.0 Å, Crystal structure of the S139A mutant of Hepatitis C Virus NS3/4A protease
4XVJ 2.0 Å, Structure of the hepatitis C virus envelope glycoprotein E2 antigenic 2 region 412-423…

Browse structure collections

About this viewer

MolViewer shows 4JZN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.