Crystal structure of mouse Cryptochrome 1. Determined by X-ray diffraction at 2.65 Å resolution. Released 26 Jun 2013.
Explore 4K0R in 3D Show helices and sheets RCSB PDB PDBe
4K0R contains 29 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-9 | 6 | 1 |
| α-helix | 19-25 | 7 | |
| β-strand | 30-37 | 8 | 1 |
| α-helix | 49-68 | 20 | |
| β-strand | 74-77 | 4 | 1 |
| α-helix | 80-90 | 11 | |
| β-strand | 95-99 | 5 | 1 |
| α-helix | 104-119 | 16 | |
| β-strand | 123-127 | 5 | 1 |
| α-helix | 135-141 | 7 | |
| α-helix | 150-157 | 8 | |
| β-strand | 179 | 1 | 1 |
| β-strand | 187 | 1 | 2 |
| β-strand | 189 | 1 | 2 |
| β-strand | 190 | 1 | 1 |
| α-helix | 192-193 | 2 | |
| α-helix | 196-198 | 3 | |
| α-helix | 214-232 | 19 | |
| α-helix | 246-247 | 2 | |
| α-helix | 252-257 | 6 | |
| α-helix | 262-276 | 15 | |
| α-helix | 284-287 | 4 | |
| α-helix | 288-300 | 13 | |
| β-strand | 321 | 1 | 3 |
| α-helix | 324-331 | 8 | |
| α-helix | 338-350 | 13 | |
| α-helix | 355-363 | 9 | |
| α-helix | 364-368 | 5 | |
| β-strand | 372 | 1 | 3 |
| α-helix | 374-384 | 11 | |
| α-helix | 390-400 | 11 | |
| α-helix | 412-414 | 3 | |
| α-helix | 417-422 | 6 | |
| α-helix | 427-432 | 6 | |
| α-helix | 434-436 | 3 | |
| α-helix | 447-449 | 3 | |
| α-helix | 452-458 | 7 | |
| β-strand | 462 | 1 | 4 |
| β-strand | 466 | 1 | 4 |
| α-helix | 467-469 | 3 | |
| α-helix | 473-485 | 13 | |
| α-helix | 486-488 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cryptochrome-1 | A | protein | 617 | Mus musculus | P97784 (AlphaFold model) |
>4K0R_1 Cryptochrome-1 (chains A) MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMT PLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN IERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGENVPSCSSSGNGGLMGYAPGE NVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSSAGTGLSSGKRPSQEEDAQSVGPKV QRQSSNAAALEHHHHHH
Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function. Czarna, A., Berndt, A., Singh, H.R. et al. Cell (2013) 153:1394-1405. DOI 10.1016/j.cell.2013.05.011 · PubMed
Other PDB entries of the same protein (UniProt P97784 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4K0R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.